DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and stx11a

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_998075.1 Gene:stx11a / 405846 ZFINID:ZDB-GENE-040426-2564 Length:294 Species:Danio rerio


Alignment Length:282 Identity:62/282 - (21%)
Similarity:115/282 - (40%) Gaps:63/282 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAAN--LETMNRMAQTVNLRTFNENEMDELHN 130
            |.:|::.|     |.:||:     .|..|........  :|...:.||::      :.|:.:|..
Zfish    18 EEEDQADS-----GDDVDN-----DEFEQHAVVFEGEDIMEDAFKKAQSI------QKEIAQLRM 66

  Fly   131 KNLRLGNQLMTRF--------------NDFKANLPAEND----------------------YSLE 159
            :..|||.| .|||              |....::..:.:                      :|..
Zfish    67 EVKRLGKQ-NTRFLTSVRRISSIKRDSNTIARSIKTKGESLYARIQKLDGLCKELEEKQGAHSAL 130

  Fly   160 ARMKRTLFYGLHQTF---INLWHKNELFLQ-NYETKVKKNLRLHTKIINSEASEQEIELLIENKT 220
            .||.|..|..:...|   :|.::..|:..: |..|::::    ..:|:..|.:|.:||.:||...
Zfish   131 VRMIRGQFISITGAFHEAMNEYNAAEMAQRDNCMTRIQR----QAEIVGKEVTEDQIEEMIETGK 191

  Fly   221 TKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQ 285
            ..:|.|:.|.:....|..|.|:.:|..||..||..|.::..||.::..||.||..::..:|.:..
Zfish   192 WNVFSDDLLTDGRTARSALTEIENRHKELLELESRIRDIRELFFQLALLVEEQGPMVDNIEANVY 256

  Fly   286 QATLHVDKGADELDQAEQHQKK 307
            ....:|.|...::.:|.:::||
Zfish   257 ATQDYVAKATTQIKKAVKYKKK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 48/221 (22%)
SNARE_syntaxin1-like 238..298 CDD:277201 17/59 (29%)
stx11aNP_998075.1 Syntaxin 47..245 CDD:279182 47/208 (23%)
SynN 47..199 CDD:238105 32/162 (20%)
SNARE 209..269 CDD:304603 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579723
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.