DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and stx11b.1

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_957156.1 Gene:stx11b.1 / 393836 ZFINID:ZDB-GENE-040426-1893 Length:295 Species:Danio rerio


Alignment Length:284 Identity:60/284 - (21%)
Similarity:122/284 - (42%) Gaps:21/284 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NNSYSVVSQNSH-----SCSNNNSSTEPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLE 106
            |:..::...:||     |.|.:|...|......:.:...|.:::.:|:...:.|:::..|...::
Zfish     6 NHLLTISETDSHLEEVESDSFSNVDLEENFSQQAVIFDNGEDMESVLDEAQDTRREIQLIRLEVK 70

  Fly   107 TMNRMAQTVNLRTFNENEMDELHNKNLR-LGNQLMTRFNDFKANLPAENDYSLE----------- 159
            .:    :..|.|..||........::.. :...:.||..|..|.|...:.::.|           
Zfish    71 RL----RDQNTRILNEPTRTSYVKRDANAIAGDIKTRGVDVLARLQKMDAHAKELQEEHGINSAV 131

  Fly   160 ARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLF 224
            ||:.||.:..|...|.:...:......|::...|::::...:|:..|.|..:||.::||....:|
Zfish   132 ARIARTQYATLSNNFQDAMTEYNDAEMNHKESCKRHIQRQMEIVGREVSGDQIEEMLENGEWNVF 196

  Fly   225 VDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATL 289
            .||.:.|.:..|..|.::..|..||..||..:..:|.:|:.:..||.||..:...:..:.|:...
Zfish   197 NDNIMSEGKTARSALNQIEHRHRELLELENRLNSLHEVFLDVAMLVEEQGPMTDYILNNVQKTDA 261

  Fly   290 HVDKGADELDQAEQHQKKARKKKI 313
            .:.:...:|.||::|......||:
Zfish   262 VLGEVLIKLAQAKRHDNNNPFKKM 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 42/191 (22%)
SNARE_syntaxin1-like 238..298 CDD:277201 13/59 (22%)
stx11b.1NP_957156.1 Syntaxin 48..246 CDD:279182 44/201 (22%)
SynN 48..200 CDD:238105 30/155 (19%)
SNARE 210..266 CDD:304603 13/55 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579725
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.