DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and Syx17

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster


Alignment Length:242 Identity:49/242 - (20%)
Similarity:100/242 - (41%) Gaps:57/242 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SKMTQYGSNVDD--ILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFNENEMDELHNKNLRLGN 137
            |.:..:.||::.  .|..:.:|:::      .|..|..:.|..||..    |||.|..|   :..
  Fly    29 SLLKNHRSNIEKSLALGDWQKIKKE------ELNAMRVIKQIKNLLL----EMDALREK---VRE 80

  Fly   138 QLMTRFNDFKANLPAENDYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKI 202
            :.:.||:|...  |..:          |.|.|:.: |..|                 .|:..|..
  Fly    81 EDLERFDDLMK--PGRD----------TAFAGMKE-FAEL-----------------QLKSPTST 115

  Fly   203 INSEASE------QEIEL--LIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEV 259
            ::|:..:      ||:::  |..::.......||    :.|...|.:.....:::..|::.|.::
  Fly   116 LSSQYDDDLDNQPQEVDMNSLPAHRHMPQLQLNF----QLEEHQLAQRQACLDQMENLQQEIYDL 176

  Fly   260 HALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQK 306
            |.:|..::.|..|||..::::..:|::|..:|.:|...|.:|..::|
  Fly   177 HGMFQGMRQLTAEQSVAVEKIADNAEEALENVQQGELNLRRALTYKK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 35/187 (19%)
SNARE_syntaxin1-like 238..298 CDD:277201 13/59 (22%)
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447432
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.