DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and stx4

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_956515.1 Gene:stx4 / 323735 ZFINID:ZDB-GENE-030131-2455 Length:297 Species:Danio rerio


Alignment Length:296 Identity:71/296 - (23%)
Similarity:137/296 - (46%) Gaps:20/296 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IGNTG-GNNNSYSVVSQNSHSCSNNNSSTEPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAA 103
            :|||. .::.....|:......|..:::.:.::.:..|..|             |||:.|..:..
Zfish     8 LGNTADASDEDEETVALMIKPGSGTSANEDKENEAFFKKVQ-------------EIREGLETLKR 59

  Fly   104 NLETMNRMAQTVNLRTFNEN----EMDELHNKNLRLGNQLMTRFNDFK-ANLPAENDY-SLEARM 162
            .:..:....:||......|:    |:..|......:.:|:..:....: ..|..|..| .:..||
Zfish    60 KVSELENKQKTVLGVALPEDSMKKELQSLREDIKGMASQIQKKLKSLEPKKLEVEEKYIPVNVRM 124

  Fly   163 KRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDN 227
            :||....|.:.|:.|..:.......|..:..:.::...||..:..|:.|:|.::|:..|.:|..|
Zfish   125 RRTQHGVLSREFLELMGRCNTIQAQYRDRNVERIKRQLKITGNSVSDDELETMLESGQTDVFTQN 189

  Fly   228 FLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVD 292
            .|.:.:..||.|.|:..|.:|:.:||:||:|:|.:|..:...|..|.|::.|:|.:.:.:..:|:
Zfish   190 ILNDAKATRQALNEIESRHDEIIKLERSIKELHDMFQYLAMEVEAQGEMVDRIESNIKMSHDYVE 254

  Fly   293 KGADELDQAEQHQKKARKKKIMLIVILAAVLLVLLL 328
            |...|.:.|.:..||.:||||.:.|.||.:||::.:
Zfish   255 KAVAETEAAVKTSKKVQKKKIYIAVCLAVLLLIIAI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 45/185 (24%)
SNARE_syntaxin1-like 238..298 CDD:277201 18/59 (31%)
stx4NP_956515.1 Syntaxin 41..236 CDD:279182 47/207 (23%)
SynN 41..190 CDD:238105 31/161 (19%)
SNARE_syntaxin4 200..262 CDD:277236 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.