DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and tlg2

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_593832.1 Gene:tlg2 / 2543436 PomBaseID:SPAC823.05c Length:301 Species:Schizosaccharomyces pombe


Alignment Length:256 Identity:53/256 - (20%)
Similarity:104/256 - (40%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 QYGSNV----DDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFNENEMDELHNKNLRLGNQL 139
            ||..:|    .|......||::...||..:.:...::.|....:|.:....:.|..||       
pombe    82 QYAKHVLPSFSDKTEQENEIQRLTIQITQDFQRCQKLLQVTKAQTNSATGSEALMAKN------- 139

  Fly   140 MTRFNDFKANLPAENDYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKI-- 202
                  |.:||.:                       .:..::..|.:...|.:||...|:..|  
pombe   140 ------FLSNLAS-----------------------RIQTESAQFRKKQSTYLKKLRGLNANISP 175

  Fly   203 INSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQ 267
            :.|:..|...::.|...|.:...  .::|..::.|.:|..    ..:.::.:.|.|:..:|..:|
pombe   176 VESKLDETVSDVAISQSTIQQVA--LMEEQGEDEQAIRHE----RAVAKIAEGIIELAQMFQDLQ 234

  Fly   268 TLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIMLIVILAAVLLVLLL 328
            .||:||..::.|::|:.:|..:|......||.:||.|||...:.:.:..:||..|.|:::|
pombe   235 VLVIEQGALVDRIDFNIEQTQVHAKSAEKELIKAESHQKNTGRLRFICFLILLIVALIVIL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 31/181 (17%)
SNARE_syntaxin1-like 238..298 CDD:277201 13/59 (22%)
tlg2NP_593832.1 COG5325 24..301 CDD:227635 53/256 (21%)
SNARE_syntaxin16 209..267 CDD:277198 15/61 (25%)
SNARE 243..293 CDD:283412 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.