DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and Stx2

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_036880.1 Gene:Stx2 / 25130 RGDID:2558 Length:290 Species:Rattus norvegicus


Alignment Length:285 Identity:65/285 - (22%)
Similarity:149/285 - (52%) Gaps:29/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DRSSSKMTQYGSN-----------VDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFN--- 121
            |.::.:.:..|.|           :|...:...|||..:|:||.::|.:.: ..::.|...|   
  Rat     7 DLTACRKSDDGDNAVIITVEKDHFMDAFFHQVEEIRSSIARIAQHVEDVKK-NHSIILSAPNPEG 70

  Fly   122 --ENEMDELHNKNLRLGNQLMTRFNDFKANLPAE---NDYSLEARMKRTLFYGLHQTFINLWHK- 180
              :.|:::|:.:..:..|::..:....:.:...:   |..|::.|::||....|.:.|:::..: 
  Rat    71 KIKEELEDLNKEIKKTANRIRGKLKAIEQSCDQDENGNRTSVDLRIRRTQHSVLSRKFVDVMTEY 135

  Fly   181 NE---LFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREM 242
            ||   ||.:..:.::::.|    :|.....:::|:|.::|:....:|:.:.:.:::..||.|.|:
  Rat   136 NEAQILFRERSKGRIQRQL----EITGRTTTDEELEEMLESGKPSIFISDIISDSQITRQALNEI 196

  Fly   243 MDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKK 307
            ..|..::.:||.||.|:|.:||.:...|..|.|::..:|.:...:..:|:...:|..:|.::|.|
  Rat   197 ESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVNSVDYVEHAKEETKKAIKYQSK 261

  Fly   308 ARKKKIMLIVILAAVLLVL-LLVGI 331
            ||:||.::..::.||:.|| |::|:
  Rat   262 ARRKKWIIAAVVVAVIAVLALIIGL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 43/191 (23%)
SNARE_syntaxin1-like 238..298 CDD:277201 16/59 (27%)
Stx2NP_036880.1 Syntaxin 31..228 CDD:279182 44/201 (22%)
SynN 31..182 CDD:238105 30/155 (19%)
SNARE_syntaxin2 192..260 CDD:277235 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.