DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and Stx4a

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_006507602.1 Gene:Stx4a / 20909 MGIID:893577 Length:475 Species:Mus musculus


Alignment Length:263 Identity:76/263 - (28%)
Similarity:135/263 - (51%) Gaps:17/263 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NNNSSTEPKDRSS----SKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFNE 122
            :|.|..|.:.|.:    |...:.||..|:.......|||.:|::.:.:..:.:...|:......|
Mouse    12 DNISDDEDEVRVALVVHSGAARLGSPDDEFFQKVQTIRQTMAKLESKVRELEKQQVTILATPLPE 76

  Fly   123 NEMDE----LHNKNLRLGNQLMTRFNDFKANLPA-----ENDYSLEARMKRTLFYGLHQTFINLW 178
            ..|.:    |..:..:||.::..:   .||..|.     ||..|:..|||:|....|.|.|:.|.
Mouse    77 ESMKQGLQNLREEIKQLGREVRAQ---LKAIEPQKEEADENYNSVNTRMKKTQHGVLSQQFVELI 138

  Fly   179 HKNELFLQNYETKVKKNLRLHTKIINS-EASEQEIELLIENKTTKLFVDNFLQETEKERQTLREM 242
            :|.......|..|..:.:|...||.|: ..|::|:|.::::..:::||.|.|::|:..||.|.|:
Mouse   139 NKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEI 203

  Fly   243 MDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKK 307
            ..|.:|:::||:||.|:|.:|..:.|.|..|.|:|.|:|.:...:..:|::|.:.:..|.::|||
Mouse   204 SARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKIALENQKK 268

  Fly   308 ARK 310
            |||
Mouse   269 ARK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 54/189 (29%)
SNARE_syntaxin1-like 238..298 CDD:277201 20/59 (34%)
Stx4aXP_006507602.1 SynN 39..189 CDD:238105 37/152 (24%)
SNARE_syntaxin4 199..260 CDD:277236 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.