DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and Stx3

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_006526907.1 Gene:Stx3 / 20908 MGIID:103077 Length:303 Species:Mus musculus


Alignment Length:324 Identity:63/324 - (19%)
Similarity:129/324 - (39%) Gaps:79/324 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLPELLQRSLSTNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVSQ---NSHSCSNNN 64
            ||||.:|..:.|:.:.....             .|..|.||...:..:|.:.:   |....|.:.
Mouse     2 KDRLEQLKAKQLTQDDDTDE-------------VEIAIDNTAFMDEFFSEIEETRLNIDKISEHV 53

  Fly    65 SST-------------EPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVN 116
            ...             |||.:            ||:....|||:::...:...|::|.:      
Mouse    54 EEAKKLYSIILSAPIPEPKTK------------DDLEQLTTEIKKRANNVRNKLKSMEK------ 100

  Fly   117 LRTFNENEMDELHNKNLRLGNQLMTRFNDFKANLPAENDYSLEARMKRTLFYGLHQTFINLWHKN 181
                 ..|.||:.:                          |.:.|::::....|.:.|:.:..|.
Mouse   101 -----HIEEDEVRS--------------------------SADLRIRKSQHSVLSRKFVEVMTKY 134

  Fly   182 ELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRF 246
            .....::..:.|..::...:|...:.:::|:|.::|:....:|....: :::..:|.|.|:..|.
Mouse   135 NEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGII-DSQISKQALSEIEGRH 198

  Fly   247 NELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARK 310
            .::.|||.||:|:|.:||.|..||..|..:|.|:|.:..|:...|::...:..:|.::|.:||:
Mouse   199 KDIVRLESSIKELHDMFMDIAMLVENQGAMIDRIENNMDQSVGFVERAVADTKKAVKYQSEARR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 34/179 (19%)
SNARE_syntaxin1-like 238..298 CDD:277201 21/59 (36%)
Stx3XP_006526907.1 Syntaxin 32..226 CDD:366315 43/243 (18%)
SNARE 194..260 CDD:389950 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.