DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and STX2

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_016874467.1 Gene:STX2 / 2054 HGNCID:3403 Length:320 Species:Homo sapiens


Alignment Length:315 Identity:70/315 - (22%)
Similarity:157/315 - (49%) Gaps:25/315 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NVYSGTTEFIIGNTGGNNNSYSVVSQNSHSCSNNNSSTEPKDRSSSKMTQYGSNVDDILNPYTEI 94
            :.:||....:|.......:::.:: |::..|..|:      |..:..:.:....:||..:...||
Human    14 SAFSGQMHTVICALKPQYSAWCLI-QSTCQCRKND------DGDTVVVVEKDHFMDDFFHQVEEI 71

  Fly    95 RQQLAQIAANLETMNRMAQTVNLRTFN-----ENEMDELHNKNLRLGNQLMTRFNDFKANLPAE- 153
            |..:.:|...:|.:.: ..::.|...|     :.|:::|:.:..:..|::..:....:.:...: 
Human    72 RNSIDKITQYVEEVKK-NHSIILSAPNPEGKIKEELEDLNKEIKKTANKIRAKLKAIEQSFDQDE 135

  Fly   154 --NDYSLEARMKRTLFYGLHQTFIN-LWHKNE---LFLQNYETKVKKNLRLHTKIINSEASEQEI 212
              |..|::.|::||....|.:.|:. :...||   ||.:..:.::::.|    :|.....::.|:
Human   136 SGNRTSVDLRIRRTQHSVLSRKFVEAMAEYNEAQTLFRERSKGRIQRQL----EITGRTTTDDEL 196

  Fly   213 ELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVI 277
            |.::|:....:|..:.:.:::..||.|.|:..|..::.:||.||.|:|.:||.:...|..|.|:|
Human   197 EEMLESGKPSIFTSDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMI 261

  Fly   278 QRVEFHAQQATLHVDKGADELDQAEQHQKKARKKK-IMLIVILAAVLLVLLLVGI 331
            ..:|.:...||.:|:...:|..:|.::|.|||:|| |::.|.:..|.::.|::|:
Human   262 NNIERNVMNATDYVEHAKEETKKAIKYQSKARRKKWIIIAVSVVLVAIIALIIGL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 41/191 (21%)
SNARE_syntaxin1-like 238..298 CDD:277201 19/59 (32%)
STX2XP_016874467.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.