DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and Stx2

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_031967.2 Gene:Stx2 / 13852 MGIID:108059 Length:289 Species:Mus musculus


Alignment Length:261 Identity:62/261 - (23%)
Similarity:140/261 - (53%) Gaps:18/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFN-----ENEMDELHNKNLRLGNQLMTRF 143
            :|...:...|||..:|:||.::|.:.: ..::.|...|     :.|:::|:.:..:..|::..:.
Mouse    30 MDGFFHQVEEIRSSIARIAQHVEDVKK-NHSIILSAPNPEGKIKEELEDLNKEIKKTANRIRGKL 93

  Fly   144 NDFKANLPAE---NDYSLEARMKRTLFYGLHQTFINLWHK-NE---LFLQNYETKVKKNLRLHTK 201
            ...:.:...:   |..|::.|::||....|.:.|:::..: ||   ||.:..:.::::.|    :
Mouse    94 KSIEQSCDQDENGNRTSVDLRIRRTQHSVLSRKFVDVMTEYNEAQILFRERSKGRIQRQL----E 154

  Fly   202 IINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRI 266
            |.....::.|:|.::|:....:|:.:.:.:::..||.|.|:..|..::.:||.||.|:|.:||.:
Mouse   155 ITGRTTTDDELEEMLESGKPSIFISDIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDM 219

  Fly   267 QTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIMLIVILAAVLLVL-LLVG 330
            ...|..|.|::..:|.:...:..:|:...:|..:|.::|.|||:||.::..:..||:.|| |::|
Mouse   220 AMFVETQGEMVNNIERNVVNSVDYVEHAKEETKKAIKYQSKARRKKWIIAAVAVAVIAVLALIIG 284

  Fly   331 I 331
            :
Mouse   285 L 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 43/191 (23%)
SNARE_syntaxin1-like 238..298 CDD:277201 16/59 (27%)
Stx2NP_031967.2 Syntaxin 30..227 CDD:279182 44/201 (22%)
SynN 30..181 CDD:238105 30/155 (19%)
SNARE_syntaxin2 191..259 CDD:277235 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.