DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and Stx1a

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_446240.2 Gene:Stx1a / 116470 RGDID:69430 Length:288 Species:Rattus norvegicus


Alignment Length:286 Identity:67/286 - (23%)
Similarity:141/286 - (49%) Gaps:23/286 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KDRSSSKMTQYGSN--------------VDDILNPYTEIRQQLAQIAANLETMNRMAQTV----N 116
            |||:....|...|:              :|:......|||..:.:||.|:|.:.|....:    |
  Rat     2 KDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPN 66

  Fly   117 LRTFNENEMDELHNKNLRLGNQLMTRFNDFKANLPAE---NDYSLEARMKRTLFYGLHQTFINLW 178
            .....:.|::||.:...:..|::.::....:.::..|   |..|.:.|:::|....|.:.|:.:.
  Rat    67 PDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVM 131

  Fly   179 HKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMM 243
            .:......:|..:.|..::...:|.....:.:|:|.::|:....:|....:.::...:|.|.|:.
  Rat   132 SEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIE 196

  Fly   244 DRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKA 308
            .|.:|:.:||.||.|:|.:||.:..||..|.|:|.|:|::.:.|..:|::...:..:|.::|.||
  Rat   197 TRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKA 261

  Fly   309 RKKKIMLIV--ILAAVLLVLLLVGIY 332
            |:||||:|:  ::..:::...:.||:
  Rat   262 RRKKIMIIICCVILGIIIASTIGGIF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 42/186 (23%)
SNARE_syntaxin1-like 238..298 CDD:277201 21/59 (36%)
Stx1aNP_446240.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20 5/17 (29%)
Syntaxin 30..227 CDD:395647 43/196 (22%)
SNARE 228..279 CDD:399038 16/50 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.