DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and STX1B

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_443106.1 Gene:STX1B / 112755 HGNCID:18539 Length:288 Species:Homo sapiens


Alignment Length:250 Identity:59/250 - (23%)
Similarity:129/250 - (51%) Gaps:10/250 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VDDILNPYTEIRQQLAQIAANLETMNRMAQTV----NLRTFNENEMDELHNKNLRLGNQLMTRFN 144
            :|:......|||..:.:::.::|.:.:....:    |.....:.|:::|.....:..|::.::..
Human    29 MDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKTKQELEDLTADIKKTANKVRSKLK 93

  Fly   145 DFKANLPAE---NDYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSE 206
            ..:.::..|   |..|.:.|:::|....|.:.|:.:..:.......|..:.|..::...:|....
Human    94 AIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRT 158

  Fly   207 ASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVM 271
            .:.:|:|.::|:....:|.|:...:::..:|.|.|:..|.||:.:||.||.|:|.:|:.:..||.
Human   159 TTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVE 223

  Fly   272 EQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIMLI---VILAAVL 323
            .|.|:|.|:|::.:.:..:|::...:..:|.::|.|||:||||:|   |:|..||
Human   224 SQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVL 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 38/186 (20%)
SNARE_syntaxin1-like 238..298 CDD:277201 20/59 (34%)
STX1BNP_443106.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Syntaxin 29..226 CDD:395647 39/196 (20%)
SNARE 227..278 CDD:399038 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.