DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and LOC103690878

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_008771591.1 Gene:LOC103690878 / 103690878 RGDID:9098358 Length:297 Species:Rattus norvegicus


Alignment Length:338 Identity:65/338 - (19%)
Similarity:134/338 - (39%) Gaps:75/338 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLPELLQRSLSTNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVSQNSHSCSNNNSST 67
            ||||.||         .|..::|::.|.: ..|..|                 ::|:.....::|
  Rat     2 KDRLEEL---------KNHINHGTVSLEL-DDTLMF-----------------DNHAFEKTETNT 39

  Fly    68 EPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFNEN---EMDELH 129
                            :::.|....|:...|.::....:.:::..|.|...|..|:   |.:||:
  Rat    40 ----------------IEEFLQEVAELSLALTELEGLSQLIDKKQQGVLCCTTEESVFKEKNELN 88

  Fly   130 NKNLRLGNQ---LMTRFNDFKANLPAENDY-SLEARMKRTLFYGLHQTFINLWHKNELFLQNYET 190
            .......:|   :..:.:..:..|..:..| ..|.|::::      |....|.|...:...:|..
  Rat    89 IIKASFASQARLIQPQLSTIQHELATDCKYWRAEHRIRQS------QLSFLLSHYRGIISHHYVC 147

  Fly   191 KVKKNLRLHTKIINS------EASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNEL 249
            :.:..:||..|::..      :..|:::|.|:.|......|...| :..|.:|.|.....|..:|
  Rat   148 ETQNMVRLKEKMVRQADLAGVKLQEEDLEKLVANPVPPQIVGRDL-DVLKAKQGLALAEVRNQQL 211

  Fly   250 RRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKK-- 312
            ..||..|.|:..:|.:::|.:..|.|::..:|:       ::.:..|.::|:.:..|||.|.|  
  Rat   212 LELECQISELRTIFFQVETFISGQQELLDSIEY-------NILRTQDYVEQSNETVKKALKYKRQ 269

  Fly   313 ---IMLIVILAAV 322
               :|:|..:|.:
  Rat   270 SRFLMVISTVAGL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 38/192 (20%)
SNARE_syntaxin1-like 238..298 CDD:277201 13/59 (22%)
LOC103690878XP_008771591.1 Syntaxin 40..228 CDD:279182 38/194 (20%)
SynN 41..176 CDD:294095 23/140 (16%)
SNARE_syntaxin1-like 201..262 CDD:277201 14/67 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339924
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.