DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and stx1a

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_001345316.3 Gene:stx1a / 100006625 ZFINID:ZDB-GENE-100802-1 Length:291 Species:Danio rerio


Alignment Length:269 Identity:60/269 - (22%)
Similarity:127/269 - (47%) Gaps:12/269 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 SSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFN-----ENEMDELHNKNL 133
            ::||......:|:......|||:.:..:|..:..:.| ..:..|.:.|     :.|.:||.|...
Zfish    23 NNKMVIEDGFMDEFFEQVEEIREFIDSLAEKVGEVKR-NHSATLASPNPDEKTKTEFEELMNDIK 86

  Fly   134 RLGNQLMTRFNDFKANLPAE---NDYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKN 195
            .|.|::.:|....:.::..|   |..|.:.|:::|....|.:.|:.:..:.......|..:.|..
Zfish    87 TLANKVRSRLQHIQQSIEHEEAFNGQSADVRIRKTQHSTLSRKFVEVMSEYNAAQSEYRERCKGR 151

  Fly   196 LRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVH 260
            ::...:|...:.:::|:|.::|:....:|......:....:|.:.|:..|.||:.:||..|.|:.
Zfish   152 IQRQLEITGRKTTKEELETILESDNPSIFTTGVFMDCSITKQAMNEIETRHNEIIQLESCIRELQ 216

  Fly   261 ALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIML---IVILAAV 322
            .:|:.:..||..|.|:|..:|.:...|..:|:|..:|...|.:.||.:|.|.|::   :.:...:
Zfish   217 DMFVDLAVLVENQGELINNIETNVSSAQEYVEKAKEETKAAIKIQKTSRTKLILIGGCVSVCVLI 281

  Fly   323 LLVLLLVGI 331
            |::.|:.|:
Zfish   282 LIIALIFGL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 40/187 (21%)
SNARE_syntaxin1-like 238..298 CDD:277201 18/59 (31%)
stx1aXP_001345316.3 Syntaxin 33..230 CDD:279182 41/197 (21%)
SynN 33..184 CDD:238105 29/151 (19%)
SNARE_syntaxin1-like 194..255 CDD:277201 19/60 (32%)
SNARE 231..284 CDD:283412 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.