DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx4 and stx11b.2

DIOPT Version :9

Sequence 1:NP_525057.2 Gene:Syx4 / 31269 FlyBaseID:FBgn0024980 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001099072.1 Gene:stx11b.2 / 100005065 ZFINID:ZDB-GENE-050417-148 Length:288 Species:Danio rerio


Alignment Length:331 Identity:63/331 - (19%)
Similarity:140/331 - (42%) Gaps:69/331 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLPELLQRSLSTNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVSQNSHS--CSNNNS 65
            :|||..|.:.|:        |||::                        ...:.:||  .|.|..
Zfish     2 RDRLGHLQEVSM--------SNGTV------------------------AEHETAHSLPASENTD 34

  Fly    66 STE-PKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQI-----------------AANLETMNRMA 112
            ..: |:|.|::      .:::.:.:...|.|:|:..|                 :|:..|.:|.|
Zfish    35 LYDLPQDSSTN------PDMEAVFDEAQEARRQIHYIRLEVKRLREQNSHFFGSSASNTTSDRNA 93

  Fly   113 QTVNLRTFNENEMDELHNKNLRLGNQLMTRFNDFKANLPAENDYSLEARMKRTLFYGLHQTFINL 177
            ...:::|..:..:..|.|.:.. |.:|.:::.   .|.|.       ||:.:|.:..:..:|.:.
Zfish    94 IAADIKTRGQEMLTHLRNMDSH-GKELESKYG---VNSPV-------ARIAQTQYSSISNSFRDA 147

  Fly   178 WHKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREM 242
            ..:......:::...|..::...:|:..:.:..:||.::|:....:|.:|.:.|.:..|..|.::
Zfish   148 MVEYNDAEMSHKESCKAYIQRQMEIVGRDVTGDQIEEMLESGQWNVFSENMVSEGKTARSALIQI 212

  Fly   243 MDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKK 307
            ..|..|:.:||:.|:.:|.:|:.:..||.|||.:...::.:.|.....|.:...:|::|::|.:.
Zfish   213 ESRHTEMVQLERRIKSLHEVFLDVAMLVEEQSSMTDYIQTNVQSTEAEVRQVLVKLERAKRHDRN 277

  Fly   308 ARKKKI 313
            ...||:
Zfish   278 NPFKKM 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx4NP_525057.2 Syntaxin 93..273 CDD:279182 38/196 (19%)
SNARE_syntaxin1-like 238..298 CDD:277201 15/59 (25%)
stx11b.2NP_001099072.1 Syntaxin 48..243 CDD:279182 38/205 (19%)
SynN 48..197 CDD:238105 25/159 (16%)
SNARE_syntaxin1-like 208..270 CDD:277201 16/61 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579724
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.