DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF566

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001138815.1 Gene:ZNF566 / 84924 HGNCID:25919 Length:419 Species:Homo sapiens


Alignment Length:211 Identity:74/211 - (35%)
Similarity:112/211 - (53%) Gaps:8/211 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 ATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRNARDG 329
            ||.:.:.:..:|:       :||.|||.....:...:|.::|....|:.|..||::|...:....
Human   188 ATHEIIHTIEKPY-------ECKECGKSFRHPSRLTHHQKIHTGKKPFECKECGKTFICGSDLTR 245

  Fly   330 HVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEK 394
            |..:|....|..|..|.|.:...|:...|..||:|.||:||..|||..:..|.:.:|...|||||
Human   246 HHRIHTGEKPYECKECGKAFSSGSNFTRHQRIHTGEKPYECKECGKAFSSGSNFTQHQRIHTGEK 310

  Fly   395 PHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERPFGCEQCG 459
            |:.|..||..|..||.||.|:|.|:.|||:.|..|:| :|.|.|:|.||..:|:.|:|:.|:.||
Human   311 PYECKECGNAFSQSSQLIKHQRIHTGEKPYECKECEK-AFRSGSDLTRHQRIHTGEKPYECKICG 374

  Fly   460 KSFKRRISLAIHRQSH 475
            |::.:...|..|.:.|
Human   375 KAYSQSSQLISHHRIH 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 5/19 (26%)
zf-H2C2_2 354..379 CDD:290200 11/24 (46%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 38/84 (45%)
zf-H2C2_2 384..407 CDD:290200 11/22 (50%)
C2H2 Zn finger 398..418 CDD:275368 10/19 (53%)
C2H2 Zn finger 426..447 CDD:275368 9/20 (45%)
zf-H2C2_2 439..464 CDD:290200 10/24 (42%)
C2H2 Zn finger 455..475 CDD:275368 6/19 (32%)
ZNF566NP_001138815.1 KRAB 6..66 CDD:214630
KRAB 6..45 CDD:279668
COG5048 <154..330 CDD:227381 49/148 (33%)
zf-C2H2 200..222 CDD:278523 6/28 (21%)
C2H2 Zn finger 202..222 CDD:275368 6/19 (32%)
zf-H2C2_2 215..237 CDD:290200 6/21 (29%)
C2H2 Zn finger 230..250 CDD:275368 5/19 (26%)
zf-H2C2_2 242..267 CDD:290200 6/24 (25%)
COG5048 <254..405 CDD:227381 57/138 (41%)
C2H2 Zn finger 258..278 CDD:275368 5/19 (26%)
zf-H2C2_2 270..295 CDD:290200 11/24 (46%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
zf-H2C2_2 298..323 CDD:290200 11/24 (46%)
C2H2 Zn finger 314..334 CDD:275368 10/19 (53%)
zf-H2C2_2 327..351 CDD:290200 12/24 (50%)
C2H2 Zn finger 342..362 CDD:275368 9/20 (45%)
zf-H2C2_2 354..379 CDD:290200 10/24 (42%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
C2H2 Zn finger 398..417 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.