DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF559

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001189335.1 Gene:ZNF559 / 84527 HGNCID:28197 Length:602 Species:Homo sapiens


Alignment Length:315 Identity:90/315 - (28%)
Similarity:137/315 - (43%) Gaps:72/315 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 EPALQCPICGKQLARKRTFQYHMRLHGQP----------------------KIRQEDNDHCIEEC 238
            |...:|..|||..........|:|.|.:.                      ::|.....:...||
Human   302 EKFYECKACGKPFTESSYLTQHLRTHSRVLPIEHKKFGKAFAFSPDLAKHIRLRTRGKHYVCNEC 366

  Fly   239 ---------LQVEPVLQAKAGEDVYEIVEKSAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLS 294
                     |.:.  ::...||..||                              |..|||..:
Human   367 GKEFTCFSKLNIH--IRVHTGEKPYE------------------------------CNKCGKAFT 399

  Fly   295 TNNSFKYHMQLHGTATPYVCTICGESFKTRNARDGHVTLHDRNN----PNRCPTCFKVYRQASSL 355
            .::....|.:.|....||.|..||::|    |...|:|:|.|.:    |.:|..|.|.:..:||.
Human   400 DSSGLIKHRRTHTGEKPYECKECGKAF----ANSSHLTVHMRTHTGEKPYQCKECGKAFINSSSF 460

  Fly   356 RTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQ 420
            ::|:..|.|:||::|..|||...:.|...:|:.:|:.|:|..|:.||:.|||||:|..|||.|:.
Human   461 KSHMQTHPGVKPYDCQQCGKAFIRSSFLIRHLRSHSAERPFECEECGKAFRYSSHLSQHKRIHTG 525

  Fly   421 EKPHPCPVCQKRSFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRISLAIHRQSH 475
            |:|:.|..| .::|..:|.|..||..|:.||||.|::|||:|.|...|..|.:||
Human   526 ERPYKCQKC-GQAFSISSGLTVHMRTHTGERPFECQECGKAFTRSTYLIRHLRSH 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
zf-H2C2_2 354..379 CDD:290200 10/24 (42%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 36/84 (43%)
zf-H2C2_2 384..407 CDD:290200 8/22 (36%)
C2H2 Zn finger 398..418 CDD:275368 12/19 (63%)
C2H2 Zn finger 426..447 CDD:275368 7/20 (35%)
zf-H2C2_2 439..464 CDD:290200 13/24 (54%)
C2H2 Zn finger 455..475 CDD:275368 8/19 (42%)
ZNF559NP_001189335.1 KRAB 78..>118 CDD:214630
KRAB 78..117 CDD:279668
C2H2 Zn finger 158..177 CDD:275368
C2H2 Zn finger 185..240 CDD:275368
COG5048 212..601 CDD:227381 90/315 (29%)
C2H2 Zn finger 213..243 CDD:275368
C2H2 Zn finger 251..299 CDD:275368
C2H2 Zn finger 307..327 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 3/21 (14%)
zf-H2C2_2 376..399 CDD:290200 9/54 (17%)
C2H2 Zn finger 391..411 CDD:275368 5/19 (26%)
zf-H2C2_2 404..428 CDD:290200 8/27 (30%)
C2H2 Zn finger 419..439 CDD:275368 9/23 (39%)
zf-H2C2_2 431..454 CDD:290200 8/22 (36%)
zf-C2H2 445..467 CDD:278523 6/21 (29%)
C2H2 Zn finger 447..467 CDD:275368 6/19 (32%)
C2H2 Zn finger 475..495 CDD:275368 6/19 (32%)
zf-H2C2_2 488..512 CDD:290200 8/23 (35%)
C2H2 Zn finger 503..523 CDD:275368 12/19 (63%)
zf-H2C2_2 515..539 CDD:290200 9/24 (38%)
C2H2 Zn finger 531..551 CDD:275368 7/20 (35%)
zf-H2C2_2 544..568 CDD:290200 13/23 (57%)
C2H2 Zn finger 559..579 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146694
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.