DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF394

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_115540.2 Gene:ZNF394 / 84124 HGNCID:18832 Length:561 Species:Homo sapiens


Alignment Length:555 Identity:136/555 - (24%)
Similarity:212/555 - (38%) Gaps:148/555 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PMDALCRVCHTASPRCLPLFKPLDDPISGKPATLASILSYCSGLEILEAELF---LPHHI----- 65
            |.:||.|:    ...|....:|             .:||....||:|..|.|   ||..:     
Human    78 PEEALSRL----RELCRRWLRP-------------ELLSKEQILELLVLEQFLTILPEELQAWVR 125

  Fly    66 --CP----DCVAKLR---------------------LSLEFKRSVHRMDRILRQSHADFCRSKKI 103
              ||    :.||.:|                     :||.:: ...|:|...|    ||||.   
Human   126 EHCPESGEEAVAVVRALQRALDGTSSQGMVTFEDTAVSLTWE-EWERLDPARR----DFCRE--- 182

  Fly   104 SAVNTRARLSTEIPEDFVLVLDDQEVTEYPAETIRDEEQLLVVESDEAESRLEAPIVQEERL-DI 167
               :.:....:.:|......::::|:  .|.:.|        :|..|.:.:|:.....:..| ..
Human   183 ---SAQKDSGSTVPPSLESRVENKEL--IPMQQI--------LEEAEPQGQLQEAFQGKRPLFSK 234

  Fly   168 ALEQHEDDLCEIVDDPDPEQRRSRLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDND 232
            ....|||.:.:...||.|    .:||.|..|                      .|...|...:.:
Human   235 CGSTHEDRVEKQSGDPLP----LKLENSPEA----------------------EGLNSISDVNKN 273

  Fly   233 HCIEECLQVEPVLQAKAGED-VYEIVEKSAQTS--ATQKTLPSGSRP------------------ 276
            ..||             ||| ....::.||:.|  ...:.:|...||                  
Human   274 GSIE-------------GEDSKNNELQNSARCSNLVLCQHIPKAERPTDSEEHGNKCKQSFHMVT 325

  Fly   277 WKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRNARDGHVTLHDRNNPNR 341
            |..|.|.....  |.....::.|:...||| ...||.|..||:|||.|:....|..:|....|..
Human   326 WHVLKPHKSDS--GDSFHHSSLFETQRQLH-EERPYKCGNCGKSFKQRSDLFRHQRIHTGEKPYG 387

  Fly   342 CPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFR 406
            |..|.|.:.|:::|..|...|:|.||:.|..||:|..|.|...:|..||:.:|...|:.||... 
Human   388 CQECGKSFSQSAALTKHQRTHTGEKPYTCLKCGERFRQNSHLNRHQSTHSRDKHFKCEECGETC- 451

  Fly   407 YSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRISLAIH 471
            :.|||..|:|.|..|:|:.|..|:| ||...|:|.:|..:|:.|:|:||..|||.|.:..:|..|
Human   452 HISNLFRHQRLHKGERPYKCEECEK-SFKQRSDLFKHHRIHTGEKPYGCSVCGKRFNQSATLIKH 515

  Fly   472 RQSH---------KAGRQRRRAEHEVGVQLEEQDE 497
            ::.|         :.|.:.|::.|.:..|...|::
Human   516 QRIHTGEKPYKCLECGERFRQSTHLIRHQRIHQNK 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871 22/113 (19%)
C2H2 Zn finger 286..306 CDD:275368 3/19 (16%)
C2H2 Zn finger 314..334 CDD:275368 8/19 (42%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
zf-H2C2_2 354..379 CDD:290200 10/24 (42%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
COG5048 378..>463 CDD:227381 33/84 (39%)
zf-H2C2_2 384..407 CDD:290200 7/22 (32%)
C2H2 Zn finger 398..418 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..447 CDD:275368 8/20 (40%)
zf-H2C2_2 439..464 CDD:290200 11/24 (46%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
ZNF394NP_115540.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..61
SCAN 60..170 CDD:128708 22/109 (20%)
KRAB_A-box 155..214 CDD:322003 13/79 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..201 1/24 (4%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..285 18/92 (20%)
C2H2 Zn finger 337..353 CDD:275368 3/15 (20%)
COG5048 356..>420 CDD:227381 23/63 (37%)
C2H2 Zn finger 360..380 CDD:275368 8/19 (42%)
C2H2 Zn finger 388..408 CDD:275368 6/19 (32%)
zf-C2H2 414..436 CDD:306579 7/21 (33%)
C2H2 Zn finger 416..436 CDD:275368 7/19 (37%)
C2H2 Zn finger 444..463 CDD:275368 8/19 (42%)
SFP1 <464..543 CDD:227516 25/79 (32%)
C2H2 Zn finger 471..491 CDD:275368 8/20 (40%)
C2H2 Zn finger 499..519 CDD:275368 7/19 (37%)
C2H2 Zn finger 527..547 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.