DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF556

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_079243.1 Gene:ZNF556 / 80032 HGNCID:25669 Length:456 Species:Homo sapiens


Alignment Length:330 Identity:86/330 - (26%)
Similarity:135/330 - (40%) Gaps:84/330 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 QCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAKAGEDVYEIVEKSAQTS 264
            :|..|||......:...|.|.|...|:.:     | :||        .||       ..:.:...
Human   148 ECSQCGKLFTHSSSLIRHKRAHSGQKLYK-----C-KEC--------GKA-------FSRPSYLQ 191

  Fly   265 ATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRNARDG 329
            ..:|| .||.:|:       .|:.|||....::|...|::.|....||.|..||:.|....:...
Human   192 THEKT-HSGEKPY-------ACQSCGKTFLRSHSLTEHVRTHTGEKPYECGQCGKGFSCPKSFRA 248

  Fly   330 HVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEK 394
            ||.:|....|..|..|.|.:|...|.|.|:::|:|.:|:||..|||.....:.:::|:..|.|||
Human   249 HVMMHAGGRPYECKHCGKAFRCQKSFRVHMIMHAGGRPYECKQCGKAYCWATSFQRHVRIHNGEK 313

  Fly   395 PHGCDICGRRFRYSSNLIAHKRCHSQEKP---------------------------HPCPVCQKR 432
            |:.|..||:.|.:.|:|..|.|.|:::||                           :.|..|.| 
Human   314 PYKCGKCGKAFGWPSSLHKHARTHAKKKPVSGGSVGKSSARPRPSTDVKSQTREKVYKCETCGK- 377

  Fly   433 SFGSTSELNRHMLVHSSERPFG---------------------------CEQCGKSFKRRISLAI 470
            ::|.:|.|::|...|:.|:|..                           ||:|||:|....:...
Human   378 TYGWSSSLHKHERKHTGEKPVNAASVGKPSGGLCSSKNVRTQIGQKPSKCEKCGKAFSCPKAFQG 442

  Fly   471 HRQSH 475
            |.:||
Human   443 HVRSH 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..362 CDD:275368 7/19 (37%)
zf-H2C2_2 354..379 CDD:290200 11/24 (46%)
C2H2 Zn finger 370..390 CDD:275368 5/19 (26%)
COG5048 378..>463 CDD:227381 32/138 (23%)
zf-H2C2_2 384..407 CDD:290200 10/22 (45%)
C2H2 Zn finger 398..418 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..447 CDD:275368 7/20 (35%)
zf-H2C2_2 439..464 CDD:290200 11/51 (22%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
ZNF556NP_079243.1 KRAB <14..43 CDD:279668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 93..125
C2H2 Zn finger 123..139 CDD:275368
COG5048 <146..294 CDD:227381 48/174 (28%)
C2H2 Zn finger 149..169 CDD:275368 6/19 (32%)
zf-H2C2_2 161..186 CDD:290200 9/45 (20%)
zf-C2H2 175..197 CDD:278523 7/43 (16%)
C2H2 Zn finger 177..197 CDD:275368 7/36 (19%)
zf-H2C2_2 189..214 CDD:290200 9/32 (28%)
C2H2 Zn finger 205..225 CDD:275368 6/19 (32%)
zf-H2C2_2 217..242 CDD:290200 9/24 (38%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
C2H2 Zn finger 261..281 CDD:275368 7/19 (37%)
C2H2 Zn finger 289..309 CDD:275368 5/19 (26%)
zf-H2C2_2 301..324 CDD:290200 9/22 (41%)
C2H2 Zn finger 317..337 CDD:275368 8/19 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..365 5/33 (15%)
C2H2 Zn finger 372..392 CDD:275368 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 386..406 4/19 (21%)
C2H2 Zn finger 427..447 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146691
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.