DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF768

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_016879154.1 Gene:ZNF768 / 79724 HGNCID:26273 Length:564 Species:Homo sapiens


Alignment Length:436 Identity:126/436 - (28%)
Similarity:178/436 - (40%) Gaps:124/436 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 YPAETIRDEEQ--LLVVESDEAESR-------LEAPIVQEER--LDIAL-------------EQH 172
            |.:|:.|.|.|  .|..:|.|.|::       .|..:..||:  |:|::             ||.
Human   166 YESESSRYESQNTELKTQSPEFEAQSSKFQEGAEMLLNPEEKSPLNISVGVHPLDSFTQGFGEQP 230

  Fly   173 EDDL------------------CEIVDDP--------DPEQRRSRLERSE---PALQCPICGKQL 208
            ..||                  .|::.:|        .|.:|..|....:   |.: |.||||..
Human   231 TGDLPIGPPFEMPTGALLSTPQFEMLQNPLGLTGALRGPGRRGGRARGGQGPRPNI-CGICGKSF 294

  Fly   209 ARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAKAGEDVY--EIVEKSAQTSAT----Q 267
            .|..|...|.|:|                           .||..|  |:..|:...|:.    |
Human   295 GRGSTLIQHQRIH---------------------------TGEKPYKCEVCSKAFSQSSDLIKHQ 332

  Fly   268 KTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRNARDGHVT 332
            :| .:|.||:|       |..|||..:.::....|.:.|....||.|..||::|...:....|..
Human   333 RT-HTGERPYK-------CPRCGKAFADSSYLLRHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQR 389

  Fly   333 LHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPHG 397
            .|....|..|..|.|.|.|.||||:|..:|:|.:||.|.||||..:|:|....|..:|..|||..
Human   390 THSHERPYSCTECGKCYSQNSSLRSHQRVHTGQRPFSCGICGKSFSQRSALIPHARSHAREKPFK 454

  Fly   398 CDICGRR----------------------------FRYSSNLIAHKRCHSQEKPHPCPVCQKRSF 434
            |..||:|                            |..||.||.|:|.|:.|:|:.|.||.| .|
Human   455 CPECGKRFGQSSVLAIHARTHLPGRTYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGK-GF 518

  Fly   435 GSTSELNRHMLVHSSERPFGCEQCGKSFKRRISLAIHRQSHKAGRQ 480
            ..:|.|.:|..|||.|||:.|:.|||:|.:...|..|:::|.|||:
Human   519 CRSSTLLQHHRVHSGERPYKCDDCGKAFSQSSDLIRHQRTHAAGRR 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 10/19 (53%)
zf-H2C2_2 354..379 CDD:290200 13/24 (54%)
C2H2 Zn finger 370..390 CDD:275368 8/19 (42%)
COG5048 378..>463 CDD:227381 39/112 (35%)
zf-H2C2_2 384..407 CDD:290200 10/50 (20%)
C2H2 Zn finger 398..418 CDD:275368 11/47 (23%)
C2H2 Zn finger 426..447 CDD:275368 8/20 (40%)
zf-H2C2_2 439..464 CDD:290200 13/24 (54%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
ZNF768XP_016879154.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.