DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF557

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001037852.1 Gene:ZNF557 / 79230 HGNCID:28632 Length:430 Species:Homo sapiens


Alignment Length:414 Identity:102/414 - (24%)
Similarity:171/414 - (41%) Gaps:85/414 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LSTEIPEDFVLVLDDQEVTEYPAETIRDEEQLLVVESDEAESRLEAPIVQEERLDIALEQHEDDL 176
            ::.|..::...:||..:.|.|....:.:...|..:.:...:.||.:.:.||:::...........
Human    48 VAVEFTQEEWALLDPAQRTLYRDVMLENCRNLASLGNQVDKPRLISQLEQEDKVMTEERGILSGT 112

  Fly   177 CEIVDDP--------------DPEQRRSRLERSEPAL---QCPICGKQLARKRTFQYHMRLHGQP 224
            |..|::|              ..:.|..::||:....   :|..|.|..:.|.:...|.::|   
Human   113 CPDVENPFKAKGLTPKLHVFRKEQSRNMKMERNHLGATLNECNQCFKVFSTKSSLTRHRKIH--- 174

  Fly   225 KIRQEDNDHCIEECLQVEPVLQAKAGEDVYEIVE-----KSAQTSATQKTLPSGSRPWKPLNPSL 284
                                    .||..|...|     .|....|..|.:.:|.:|:       
Human   175 ------------------------TGERPYGCSECGKSYSSRSYLAVHKRIHNGEKPY------- 208

  Fly   285 QCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVY 349
            :|..|||..|:.:....|.::|....||.|:.||::|...:....|:.:|....|.:|..||:.:
Human   209 ECNDCGKTFSSRSYLTVHKRIHNGEKPYECSDCGKTFSNSSYLRPHLRIHTGEKPYKCNQCFREF 273

  Fly   350 R----------------------------QASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKH 386
            |                            ..|||.:|..||:|..|:||..||:...::|...:|
Human   274 RTQSIFTRHKRVHTGEGHYVCNQCGKAFGTRSSLSSHYSIHTGEYPYECHDCGRTFRRRSNLTQH 338

  Fly   387 MLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSER 451
            :.|||||||:.|:.||:.|..|.:|..|:|.|:.||.:.|..|.| ||...|.:.:||..|:.::
Human   339 IRTHTGEKPYTCNECGKSFTNSFSLTIHRRIHNGEKSYECSDCGK-SFNVLSSVKKHMRTHTGKK 402

  Fly   452 PFGCEQCGKSFKRRISLAIHRQSH 475
            |:.|..|||||.....|::|.:.|
Human   403 PYECNYCGKSFTSNSYLSVHTRMH 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 8/47 (17%)
zf-H2C2_2 354..379 CDD:290200 11/24 (46%)
C2H2 Zn finger 370..390 CDD:275368 5/19 (26%)
COG5048 378..>463 CDD:227381 35/84 (42%)
zf-H2C2_2 384..407 CDD:290200 12/22 (55%)
C2H2 Zn finger 398..418 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..447 CDD:275368 8/20 (40%)
zf-H2C2_2 439..464 CDD:290200 10/24 (42%)
C2H2 Zn finger 455..475 CDD:275368 8/19 (42%)
ZNF557NP_001037852.1 KRAB 43..100 CDD:214630 10/51 (20%)
KRAB 43..82 CDD:279668 6/33 (18%)
COG5048 <137..422 CDD:227381 87/319 (27%)
C2H2 Zn finger 154..174 CDD:275368 5/19 (26%)
C2H2 Zn finger 182..202 CDD:275368 4/19 (21%)
zf-H2C2_2 194..219 CDD:290200 8/31 (26%)
C2H2 Zn finger 210..230 CDD:275368 6/19 (32%)
zf-H2C2_2 222..247 CDD:290200 8/24 (33%)
C2H2 Zn finger 238..258 CDD:275368 5/19 (26%)
zf-H2C2_2 254..275 CDD:290200 6/20 (30%)
C2H2 Zn finger 266..286 CDD:275368 4/19 (21%)
C2H2 Zn finger 294..314 CDD:275368 4/19 (21%)
zf-C2H2 320..342 CDD:278523 6/21 (29%)
C2H2 Zn finger 322..342 CDD:275368 5/19 (26%)
zf-H2C2_2 334..359 CDD:290200 12/24 (50%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
zf-H2C2_2 362..386 CDD:290200 10/24 (42%)
C2H2 Zn finger 378..398 CDD:275368 8/20 (40%)
zf-H2C2_2 390..415 CDD:290200 10/24 (42%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.