DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF177

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001166122.1 Gene:ZNF177 / 7730 HGNCID:12966 Length:481 Species:Homo sapiens


Alignment Length:434 Identity:122/434 - (28%)
Similarity:188/434 - (43%) Gaps:73/434 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 CRSKKISAVNTRARLSTEIPEDFVLVLD--DQEVTEYPAETI--------RDEEQLLVVESDEAE 152
            ||...||.|: :.:|.|:  |..:|..|  |.|....|.:||        :....:...|:...|
Human    58 CRHSLISKVD-QEQLKTD--ERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGINTAENQPGE 119

  Fly   153 SRLEAPIVQEERLD---IALEQHEDDLC-------EIVDDPDPEQRRSRLERSEPALQCPICGKQ 207
            ..||.....:.|.:   |.....:.:.|       ::.:.|...:....:...|..|:...|.|.
Human   120 HSLECNHCGKFRKNTRFICTRYCKGEKCYKYIKYSKVFNHPSTLRSHVSIHIGEKTLEFTDCRKA 184

  Fly   208 LARKRTFQYHMR------------------LHGQPKIRQ-----EDNDHCIEECLQVEPV-LQAK 248
            ..::.:.:.|:|                  ||....:|:     |..|.| .:..::.|: :..|
Human   185 FNQESSLRKHLRTPTGQKFQEYEQCDMSFSLHSSCSVREQIPTGEKGDEC-SDYGKISPLSVHTK 248

  Fly   249 AGEDVYEIVEKSAQTSATQKTLP------------SGSRPWKPLNPSLQCKICGKQLSTNNSFKY 301
            .|.     ||:..:.:..:||..            ||..|:       :|..|||.....:|.|.
Human   249 TGS-----VEEGLECNEHEKTFTDPLSLQNCVRTHSGEMPY-------ECSDCGKAFIFQSSLKK 301

  Fly   302 HMQLHGTATPYVCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIK 366
            ||:.|....||.|..||:||...:..:.|...|....|..|..|.|.:...|||:.|:..|:|.|
Human   302 HMRSHTGEKPYECDHCGKSFSQSSHLNVHKRTHTGEKPYDCKECGKAFTVPSSLQKHVRTHTGEK 366

  Fly   367 PFECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQK 431
            |:|||.|||....:|..|||..:||||||:.|:.||:.|...|.||.|||.|:.||.:.|..|.|
Human   367 PYECSDCGKAFIDQSSLKKHTRSHTGEKPYECNQCGKSFSTGSYLIVHKRTHTGEKTYECKECGK 431

  Fly   432 RSFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRISLAIHRQSH 475
             :|.::|.|..|:..|:.|:|:.|.||.|:|....:|.:|::.|
Human   432 -AFRNSSCLRVHVRTHTGEKPYKCIQCEKAFSTSTNLIMHKRIH 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 8/19 (42%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..362 CDD:275368 7/19 (37%)
zf-H2C2_2 354..379 CDD:290200 13/24 (54%)
C2H2 Zn finger 370..390 CDD:275368 9/19 (47%)
COG5048 378..>463 CDD:227381 37/84 (44%)
zf-H2C2_2 384..407 CDD:290200 13/22 (59%)
C2H2 Zn finger 398..418 CDD:275368 10/19 (53%)
C2H2 Zn finger 426..447 CDD:275368 7/20 (35%)
zf-H2C2_2 439..464 CDD:290200 10/24 (42%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
ZNF177NP_001166122.1 KRAB 14..70 CDD:214630 5/12 (42%)
C2H2 Zn finger 124..142 CDD:275368 2/17 (12%)
C2H2 Zn finger 150..170 CDD:275368 1/19 (5%)
C2H2 Zn finger 178..197 CDD:275368 3/18 (17%)
COG5048 <212..442 CDD:227381 81/243 (33%)
C2H2 Zn finger 258..278 CDD:275368 2/19 (11%)
C2H2 Zn finger 286..306 CDD:275368 8/19 (42%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..362 CDD:275368 7/19 (37%)
C2H2 Zn finger 370..390 CDD:275368 9/19 (47%)
C2H2 Zn finger 398..418 CDD:275368 10/19 (53%)
C2H2 Zn finger 426..446 CDD:275368 7/20 (35%)
zf-H2C2_2 439..463 CDD:404364 10/23 (43%)
C2H2 Zn finger 454..474 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146744
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.