DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF133

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001374224.1 Gene:ZNF133 / 7692 HGNCID:12917 Length:691 Species:Homo sapiens


Alignment Length:328 Identity:102/328 - (31%)
Similarity:139/328 - (42%) Gaps:54/328 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 RRSRLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEEC----LQVEPVL--- 245
            |..:....|..:.|..||:...||.|...|.|.|...|      .:...||    .|...::   
Human   296 RHQKAHSGEKPIVCRECGRGFNRKSTLIIHERTHSGEK------PYMCSECGRGFSQKSNLIIHQ 354

  Fly   246 QAKAGEDVYEIVE-------KSA-----QTSATQKTL---------------------PSGSRPW 277
            :..:||..|...|       |||     :|...:||:                     .||.:|:
Human   355 RTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCSDCGLGFSDRSNLISHQRTHSGEKPY 419

  Fly   278 KPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRNARDGHVTLHDRNNPNRC 342
                   .||.||:......:...|.:.|....||||.:||.||...:....|...|....|..|
Human   420 -------ACKECGRCFRQRTTLVNHQRTHSKEKPYVCGVCGHSFSQNSTLISHRRTHTGEKPYVC 477

  Fly   343 PTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRY 407
            ..|.:.:...|.|..|..||||.||..|..||:..:|:|...:|..||:||||..|..|||.|..
Human   478 GVCGRGFSLKSHLNRHQNIHSGEKPIVCKDCGRGFSQQSNLIRHQRTHSGEKPMVCGECGRGFSQ 542

  Fly   408 SSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRISLAIHR 472
            .|||:||:|.||.|:|:.|..| .|.|...:.|.||...||.|:|:.|.|||..|..:.:|..|:
Human   543 KSNLVAHQRTHSGERPYVCREC-GRGFSHQAGLIRHKRKHSREKPYMCRQCGLGFGNKSALITHK 606

  Fly   473 QSH 475
            ::|
Human   607 RAH 609

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..362 CDD:275368 5/19 (26%)
zf-H2C2_2 354..379 CDD:290200 11/24 (46%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 39/84 (46%)
zf-H2C2_2 384..407 CDD:290200 12/22 (55%)
C2H2 Zn finger 398..418 CDD:275368 11/19 (58%)
C2H2 Zn finger 426..447 CDD:275368 7/20 (35%)
zf-H2C2_2 439..464 CDD:290200 12/24 (50%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
ZNF133NP_001374224.1 KRAB 1..60 CDD:214630
COG5048 252..661 CDD:227381 102/328 (31%)
C2H2 Zn finger 253..273 CDD:275368
C2H2 Zn finger 281..301 CDD:275368 1/4 (25%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
C2H2 Zn finger 337..357 CDD:275368 3/19 (16%)
C2H2 Zn finger 365..385 CDD:275368 4/19 (21%)
C2H2 Zn finger 393..413 CDD:275368 0/19 (0%)
C2H2 Zn finger 421..441 CDD:275368 5/19 (26%)
C2H2 Zn finger 449..469 CDD:275368 6/19 (32%)
C2H2 Zn finger 477..497 CDD:275368 5/19 (26%)
C2H2 Zn finger 505..525 CDD:275368 6/19 (32%)
C2H2 Zn finger 533..553 CDD:275368 11/19 (58%)
C2H2 Zn finger 561..581 CDD:275368 7/20 (35%)
C2H2 Zn finger 589..609 CDD:275368 7/19 (37%)
C2H2 Zn finger 617..637 CDD:275368
C2H2 Zn finger 645..664 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146631
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.