DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF69

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_006722936.1 Gene:ZNF69 / 7620 HGNCID:13138 Length:569 Species:Homo sapiens


Alignment Length:333 Identity:101/333 - (30%)
Similarity:144/333 - (43%) Gaps:64/333 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 RLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQA-------- 247
            |:...|...:|..|||..:...|.:.|.|.|...|         ..||.|......:        
Human   243 RIHTGEKPYECKQCGKSFSYSATLRIHERTHTGEK---------PYECQQCGKAFHSPRCYRRHE 298

  Fly   248 --KAGEDVYEIVEKSAQTSATQ-----KTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQL 305
              ..||..|:..|.....:..|     :...|..:|:       :|..|||.||:..||:.|:::
Human   299 RIHTGEKAYQCKECGKAFTCPQYVRIHERTHSRKKPY-------ECTQCGKALSSLTSFQTHIRM 356

  Fly   306 HGTATPYVCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFEC 370
            |....||.|.|||:.|.:.|:...|...|....|.:|..|.|.:..:||||.|..||:|.||:||
Human   357 HSGERPYECKICGKGFCSANSFQRHEKTHSGEKPYKCKQCGKAFIHSSSLRYHERIHTGEKPYEC 421

  Fly   371 SICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHK------RCHSQEKPHPCPVC 429
            ..|||.....|..:.|..|||||||:.|..||:.||...||.:|:      |.||.|:|:.|.:|
Human   422 KQCGKAFRSSSHLQLHGRTHTGEKPYECQECGKAFRSMKNLQSHERTQTHVRIHSGERPYKCKLC 486

  Fly   430 QK---------------------------RSFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRIS 467
            .|                           .:|.|:|....|...|:.|:|:.|:||||:|:....
Human   487 GKGFYCPKSLQRHEKTHTGEKLYECKQCGEAFSSSSSFRYHERTHTGEKPYKCKQCGKAFRAASV 551

  Fly   468 LAIHRQSH 475
            |.:|.::|
Human   552 LRMHGRTH 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 9/19 (47%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..362 CDD:275368 8/19 (42%)
zf-H2C2_2 354..379 CDD:290200 14/24 (58%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 37/117 (32%)
zf-H2C2_2 384..407 CDD:290200 12/22 (55%)
C2H2 Zn finger 398..418 CDD:275368 9/25 (36%)
C2H2 Zn finger 426..447 CDD:275368 7/47 (15%)
zf-H2C2_2 439..464 CDD:290200 10/24 (42%)
C2H2 Zn finger 455..475 CDD:275368 8/19 (42%)
ZNF69XP_006722936.1 KRAB 27..>67 CDD:214630
KRAB 27..66 CDD:279668
C2H2 Zn finger 169..189 CDD:275368
C2H2 Zn finger 197..217 CDD:275368
COG5048 222..>540 CDD:227381 92/312 (29%)
C2H2 Zn finger 225..245 CDD:275368 1/1 (100%)
zf-H2C2_2 241..262 CDD:290200 6/18 (33%)
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
zf-H2C2_2 266..290 CDD:290200 7/32 (22%)
C2H2 Zn finger 281..301 CDD:275368 2/19 (11%)
zf-H2C2_2 295..318 CDD:290200 4/22 (18%)
C2H2 Zn finger 309..329 CDD:275368 2/19 (11%)
C2H2 Zn finger 337..357 CDD:275368 9/19 (47%)
zf-H2C2_2 349..372 CDD:290200 10/22 (45%)
C2H2 Zn finger 365..385 CDD:275368 7/19 (37%)
zf-H2C2_2 377..400 CDD:290200 6/22 (27%)
C2H2 Zn finger 393..413 CDD:275368 8/19 (42%)
zf-H2C2_2 405..430 CDD:290200 14/24 (58%)
C2H2 Zn finger 421..441 CDD:275368 6/19 (32%)
C2H2 Zn finger 449..468 CDD:275368 8/18 (44%)
C2H2 Zn finger 483..503 CDD:275368 3/19 (16%)
zf-H2C2_2 495..520 CDD:290200 1/24 (4%)
C2H2 Zn finger 511..531 CDD:275368 4/19 (21%)
zf-H2C2_2 523..546 CDD:290200 9/22 (41%)
C2H2 Zn finger 539..559 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.