Sequence 1: | NP_570028.1 | Gene: | CG2712 / 31267 | FlyBaseID: | FBgn0024975 | Length: | 501 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005259261.1 | Gene: | MZF1 / 7593 | HGNCID: | 13108 | Length: | 775 | Species: | Homo sapiens |
Alignment Length: | 328 | Identity: | 97/328 - (29%) |
---|---|---|---|
Similarity: | 154/328 - (46%) | Gaps: | 42/328 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 186 EQRRSRLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAK-- 248
Fly 249 ----AGE-----DVYEIVEKSAQTSA--TQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYH 302
Fly 303 MQLHGTATPYVCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKP 367
Fly 368 FECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKR 432
Fly 433 SFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRISLAIHRQSHKAGRQRRRAEHEVGVQLEEQDE 497
Fly 498 NVE 500 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2712 | NP_570028.1 | zf-AD | 13..92 | CDD:214871 | |
C2H2 Zn finger | 286..306 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 314..334 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 342..362 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 354..379 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 6/19 (32%) | ||
COG5048 | 378..>463 | CDD:227381 | 35/84 (42%) | ||
zf-H2C2_2 | 384..407 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 398..418 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 426..447 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 439..464 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 455..475 | CDD:275368 | 8/19 (42%) | ||
MZF1 | XP_005259261.1 | SCAN | 81..193 | CDD:128708 | |
COG5048 | 399..757 | CDD:227381 | 96/316 (30%) | ||
C2H2 Zn finger | 399..419 | CDD:275368 | |||
C2H2 Zn finger | 427..447 | CDD:275368 | |||
C2H2 Zn finger | 455..475 | CDD:275368 | 3/6 (50%) | ||
C2H2 Zn finger | 483..503 | CDD:275370 | 5/19 (26%) | ||
C2H2 Zn finger | 528..548 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 556..576 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 584..604 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 612..632 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 640..660 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 668..688 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 696..716 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 724..744 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 752..772 | CDD:275368 | 1/16 (6%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.960 |