DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and MZF1

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_005259261.1 Gene:MZF1 / 7593 HGNCID:13108 Length:775 Species:Homo sapiens


Alignment Length:328 Identity:97/328 - (29%)
Similarity:154/328 - (46%) Gaps:42/328 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 EQRRSRLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAK-- 248
            |:.| |:...|...:|..||:...::.....|.|:||.|                  |...||  
Human   469 EEHR-RVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDP------------------PGPGAKPP 514

  Fly   249 ----AGE-----DVYEIVEKSAQTSA--TQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYH 302
                |.|     ...|..|..|:.:.  ..:.:.:|.:       |..|..||::....:....|
Human   515 APPGAPEPPGPFPCSECRESFARRAVLLEHQAVHTGDK-------SFGCVECGERFGRRSVLLQH 572

  Fly   303 MQLHGTATPYVCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKP 367
            .::|....|:.|..||:||:.|:....|..:|....|..|..|.|.:||..:|..||.:|:|.||
Human   573 RRVHSGERPFACAECGQSFRQRSNLTQHRRIHTGERPFACAECGKAFRQRPTLTQHLRVHTGEKP 637

  Fly   368 FECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKR 432
            |.|..||:|.:|:....:|..|||||||:.|..||..|...|.|..|:|.|:.|:|..||.| .:
Human   638 FACPECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPEC-GQ 701

  Fly   433 SFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRISLAIHRQSHKAGRQRRRAEHEVGVQLEEQDE 497
            ||...:.|.:|..:|:.|||:.|.:|||:|::|.:|..|.::|:  |::..|..:.|.:..:..:
Human   702 SFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHR--REKPFACQDCGRRFHQSTK 764

  Fly   498 NVE 500
            .::
Human   765 LIQ 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 4/19 (21%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..362 CDD:275368 8/19 (42%)
zf-H2C2_2 354..379 CDD:290200 12/24 (50%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 35/84 (42%)
zf-H2C2_2 384..407 CDD:290200 12/22 (55%)
C2H2 Zn finger 398..418 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..447 CDD:275368 7/20 (35%)
zf-H2C2_2 439..464 CDD:290200 11/24 (46%)
C2H2 Zn finger 455..475 CDD:275368 8/19 (42%)
MZF1XP_005259261.1 SCAN 81..193 CDD:128708
COG5048 399..757 CDD:227381 96/316 (30%)
C2H2 Zn finger 399..419 CDD:275368
C2H2 Zn finger 427..447 CDD:275368
C2H2 Zn finger 455..475 CDD:275368 3/6 (50%)
C2H2 Zn finger 483..503 CDD:275370 5/19 (26%)
C2H2 Zn finger 528..548 CDD:275368 3/19 (16%)
C2H2 Zn finger 556..576 CDD:275368 4/19 (21%)
C2H2 Zn finger 584..604 CDD:275368 7/19 (37%)
C2H2 Zn finger 612..632 CDD:275368 8/19 (42%)
C2H2 Zn finger 640..660 CDD:275368 6/19 (32%)
C2H2 Zn finger 668..688 CDD:275368 8/19 (42%)
C2H2 Zn finger 696..716 CDD:275368 7/20 (35%)
C2H2 Zn finger 724..744 CDD:275368 8/19 (42%)
C2H2 Zn finger 752..772 CDD:275368 1/16 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.