DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF35

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_003411.3 Gene:ZNF35 / 7584 HGNCID:13099 Length:527 Species:Homo sapiens


Alignment Length:413 Identity:106/413 - (25%)
Similarity:171/413 - (41%) Gaps:115/413 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 QLLVVESDEAESRLEAPIVQEERLDIALEQHED--DLCE--------------------IVDD-- 182
            ||||.:::..| ..|.|::..||:..|..|..:  :.||                    ||:|  
Human   120 QLLVPKTEICE-EAEKPLIISERIQKADPQGPELGEACEKGNMLKRQRIKREKKDFRQVIVNDCH 183

  Fly   183 -PD--PEQRRSRLERS------------EPALQ-------CPICGKQLARKRTFQYHMRLHGQPK 225
             |:  .|:...:.::|            .|..|       |.:|||..::......|.|:|    
Human   184 LPESFKEEENQKCKKSGGKYSLNSGAVKNPKTQLGQKPFTCSVCGKGFSQSANLVVHQRIH---- 244

  Fly   226 IRQEDNDHCIEECLQVEPVLQAKAGEDVYEIVE------KSAQTSATQKTLPSGSRPWKPLNPSL 284
                                   .||..:|..|      :||.....|: :.:|.:|:       
Human   245 -----------------------TGEKPFECHECGKAFIQSANLVVHQR-IHTGQKPY------- 278

  Fly   285 QCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVY 349
            .|..|||..:.:::...|.::|.....:.|..|.::|...:....|..:|.......|..|.|.:
Human   279 VCSKCGKAFTQSSNLTVHQKIHSLEKTFKCNECEKAFSYSSQLARHQKVHITEKCYECNECGKTF 343

  Fly   350 RQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAH 414
            .::|:|..|..||:|.|||.|:.|||..||.:....|..:||||||:.|..||:.|...|:||.|
Human   344 TRSSNLIVHQRIHTGEKPFACNDCGKAFTQSANLIVHQRSHTGEKPYECKECGKAFSCFSHLIVH 408

  Fly   415 KRCHSQEKPHPCPVCQK---------------------------RSFGSTSELNRHMLVHSSERP 452
            :|.|:.|||:.|..|.|                           ::|..:|.|..|..:|:.|:|
Human   409 QRIHTAEKPYDCSECGKAFSQLSCLIVHQRIHSGDLPYVCNECGKAFTCSSYLLIHQRIHNGEKP 473

  Fly   453 FGCEQCGKSFKRRISLAIHRQSH 475
            :.|.:|||:|::|.||.:|:::|
Human   474 YTCNECGKAFRQRSSLTVHQRTH 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 4/19 (21%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
zf-H2C2_2 354..379 CDD:290200 12/24 (50%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
COG5048 378..>463 CDD:227381 36/111 (32%)
zf-H2C2_2 384..407 CDD:290200 11/22 (50%)
C2H2 Zn finger 398..418 CDD:275368 9/19 (47%)
C2H2 Zn finger 426..447 CDD:275368 7/47 (15%)
zf-H2C2_2 439..464 CDD:290200 10/24 (42%)
C2H2 Zn finger 455..475 CDD:275368 9/19 (47%)
ZNF35NP_003411.3 Globular domain 9..221 21/101 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..38
COG5048 <214..369 CDD:227381 42/189 (22%)
C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
C2H2 Zn finger 252..272 CDD:275368 4/20 (20%)
C2H2 Zn finger 280..300 CDD:275368 5/19 (26%)
C2H2 Zn finger 308..328 CDD:275368 4/19 (21%)
C2H2 Zn finger 336..356 CDD:275368 6/19 (32%)
C2H2 Zn finger 364..384 CDD:275368 7/19 (37%)
COG5048 372..>449 CDD:227381 25/76 (33%)
C2H2 Zn finger 392..412 CDD:275368 9/19 (47%)
C2H2 Zn finger 420..440 CDD:275368 3/19 (16%)
C2H2 Zn finger 448..468 CDD:275368 4/19 (21%)
zf-H2C2_2 460..485 CDD:316026 10/24 (42%)
zf-C2H2 474..496 CDD:306579 9/21 (43%)
C2H2 Zn finger 476..496 CDD:275368 9/19 (47%)
zf-H2C2_2 488..513 CDD:316026 4/9 (44%)
C2H2 Zn finger 504..524 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.