DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF10

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_056209.2 Gene:ZNF10 / 7556 HGNCID:12879 Length:573 Species:Homo sapiens


Alignment Length:559 Identity:135/559 - (24%)
Similarity:209/559 - (37%) Gaps:174/559 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PDCVAKLRLSLE---FKRSVHRMDRILRQSHADFCRSKKI-SAVNTRA----RLSTEIPED---- 119
            ||.:.:|....|   .:|.:|      :::|.|...:.:| |:|::|:    :.|.:|..:    
Human    60 PDVILRLEKGEEPWLVEREIH------QETHPDSETAFEIKSSVSSRSIFKDKQSCDIKMEGMAR 118

  Fly   120 ---FVLVLDD--------QEVTEYPAETIRD----EEQLLVVESDEAESR------LEAPIVQEE 163
               :.|.|::        .:..|.|...:|.    ::::|..|......:      |.|.:|..|
Human   119 NDLWYLSLEEVWKCRDQLDKYQENPERHLRQVAFTQKKVLTQERVSESGKYGGNCLLPAQLVLRE 183

  Fly   164 ------------RLDIALEQHEDD-----------LCEIV---------------DDPDPEQRRS 190
                        :.|:.|..|:|.           .|:.:               ..||.:...:
Human   184 YFHKRDSHTKSLKHDLVLNGHQDSCASNSNECGQTFCQNIHLIQFARTHTGDKSYKCPDNDNSLT 248

  Fly   191 R---------LERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQ 246
            .         :.|.:| .:|..|||..:.:.....|..:|                         
Human   249 HGSSLGISKGIHREKP-YECKECGKFFSWRSNLTRHQLIH------------------------- 287

  Fly   247 AKAGEDVYEIVE------KSAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLS----------- 294
              .||..||..|      :|:.....||| .:|..|:       :||.|||..|           
Human   288 --TGEKPYECKECGKSFSRSSHLIGHQKT-HTGEEPY-------ECKECGKSFSWFSHLVTHQRT 342

  Fly   295 -----------TNNSFKY------HMQLHGTATPYVCTICGESFKTRNARDGHVTLHDRNN---- 338
                       ...||.:      |.:.|....||.|..||:||:    :..|:.||.|.:    
Human   343 HTGDKLYTCNQCGKSFVHSSRLIRHQRTHTGEKPYECPECGKSFR----QSTHLILHQRTHVRVR 403

  Fly   339 PNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGR 403
            |..|..|.|.|.|.|.|..|..||:|:|||||..|||..::.|....|..|||||||:.|..||:
Human   404 PYECNECGKSYSQRSHLVVHHRIHTGLKPFECKDCGKCFSRSSHLYSHQRTHTGEKPYECHDCGK 468

  Fly   404 RFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRISL 468
            .|..||.||.|:|.|:.|||:.|..|.| :|...::|.:|..:|..|..:.|.|||..|.:....
Human   469 SFSQSSALIVHQRIHTGEKPYECCQCGK-AFIRKNDLIKHQRIHVGEETYKCNQCGIIFSQNSPF 532

  Fly   469 AIHRQSH---------KAGRQRRRAEHEVGVQLEEQDEN 498
            .:|:.:|         :.|.......:.:|.|.....||
Human   533 IVHQIAHTGEQFLTCNQCGTALVNTSNLIGYQTNHIREN 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871 6/27 (22%)
C2H2 Zn finger 286..306 CDD:275368 9/47 (19%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..362 CDD:275368 8/19 (42%)
zf-H2C2_2 354..379 CDD:290200 13/24 (54%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 35/84 (42%)
zf-H2C2_2 384..407 CDD:290200 12/22 (55%)
C2H2 Zn finger 398..418 CDD:275368 10/19 (53%)
C2H2 Zn finger 426..447 CDD:275368 6/20 (30%)
zf-H2C2_2 439..464 CDD:290200 9/24 (38%)
C2H2 Zn finger 455..475 CDD:275368 6/19 (32%)
ZNF10NP_056209.2 KRAB 14..73 CDD:214630 4/12 (33%)
C2H2 Zn finger 213..232 CDD:275368 1/18 (6%)
C2H2 Zn finger 267..287 CDD:275368 5/19 (26%)
COG5048 <272..474 CDD:227381 68/240 (28%)
C2H2 Zn finger 295..315 CDD:275368 5/20 (25%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 351..371 CDD:275368 3/19 (16%)
C2H2 Zn finger 379..399 CDD:275368 9/23 (39%)
C2H2 Zn finger 407..427 CDD:275368 8/19 (42%)
C2H2 Zn finger 435..455 CDD:275368 6/19 (32%)
C2H2 Zn finger 463..483 CDD:275368 10/19 (53%)
C2H2 Zn finger 491..511 CDD:275368 6/20 (30%)
C2H2 Zn finger 519..539 CDD:275368 6/19 (32%)
C2H2 Zn finger 547..567 CDD:275368 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.