DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and Zfp558

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_082436.1 Gene:Zfp558 / 72230 MGIID:1921681 Length:407 Species:Mus musculus


Alignment Length:375 Identity:111/375 - (29%)
Similarity:177/375 - (47%) Gaps:37/375 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 QEVTEYPAETIR--DEEQLLVVESDEAESRLEAPIVQEERLDIA-LEQHED--DLCEIVDDPDPE 186
            :|:..:...|::  .||..|:   |..:..|...:..|...::| |.||.|  :|...:::.|..
Mouse    40 EELVSFEDVTVQFTQEEWALL---DPLQRTLYRNVTLENWKNLASLGQHLDKPNLISQLEEEDKV 101

  Fly   187 QRRSR--LERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDH---CIEECLQVEPVLQ 246
            .|..|  :....|.|:..:..|.|..|.........:|...::.|:..|   .:.||.|...|..
Mouse   102 IREDRGIIPGIHPDLEKVLKAKWLTPKNLIFSKEHDNGGKTVQLEERGHHGMKVNECNQCFKVFS 166

  Fly   247 AKA----------GEDVYEIVE-----KSAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTN 296
            .|:          ||..|:..:     :|.......:.:.:|.:|:       :|..|||..|..
Mouse   167 TKSNLTQHKRIHTGEKPYDCTQCGKSFRSKSYLTVHRRIHNGEKPF-------ECNHCGKAFSDP 224

  Fly   297 NSFKYHMQLHGTATPYVCTICGESFKTRNARDGHVTLH-DRNNPNRCPTCFKVYRQASSLRTHLL 360
            :|.:.|:::|....||.|:.|...|:|......|..:| ...|.:.|..|.|.:...|||..|..
Mouse   225 SSLRLHVRIHTGEKPYECSQCFHVFRTSCNLKSHKRIHTGGENQHECSQCGKAFSTRSSLTGHNS 289

  Fly   361 IHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHP 425
            ||:|.|||||..|||...:.|...:|:.|||||||:.|:.||:.|..|.:|..|||.|:.|||:.
Mouse   290 IHTGEKPFECQECGKTFRKSSYLTQHLRTHTGEKPYECNECGKSFSSSFSLTVHKRIHTGEKPYE 354

  Fly   426 CPVCQKRSFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRISLAIHRQSH 475
            |..|.| :|.:.|.:.:|::.|:.::|:||..|||||.....|::|::.|
Mouse   355 CSHCGK-AFNNLSAVKKHLMTHTGQKPYGCNHCGKSFTSNSYLSVHKRVH 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 7/19 (37%)
zf-H2C2_2 354..379 CDD:290200 14/24 (58%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 36/84 (43%)
zf-H2C2_2 384..407 CDD:290200 12/22 (55%)
C2H2 Zn finger 398..418 CDD:275368 9/19 (47%)
C2H2 Zn finger 426..447 CDD:275368 6/20 (30%)
zf-H2C2_2 439..464 CDD:290200 10/24 (42%)
C2H2 Zn finger 455..475 CDD:275368 8/19 (42%)
Zfp558NP_082436.1 KRAB 43..100 CDD:214630 13/59 (22%)
COG5048 <125..403 CDD:227381 90/285 (32%)
C2H2 Zn finger 158..178 CDD:275368 4/19 (21%)
C2H2 Zn finger 186..206 CDD:275368 1/19 (5%)
C2H2 Zn finger 214..234 CDD:275368 7/19 (37%)
C2H2 Zn finger 242..262 CDD:275368 5/19 (26%)
C2H2 Zn finger 271..291 CDD:275368 7/19 (37%)
C2H2 Zn finger 299..319 CDD:275368 6/19 (32%)
C2H2 Zn finger 327..347 CDD:275368 9/19 (47%)
C2H2 Zn finger 355..375 CDD:275368 6/20 (30%)
C2H2 Zn finger 383..403 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.