DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF529

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001139121.1 Gene:ZNF529 / 57711 HGNCID:29328 Length:563 Species:Homo sapiens


Alignment Length:285 Identity:91/285 - (31%)
Similarity:138/285 - (48%) Gaps:28/285 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 RLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEEC-------LQVEPVLQAK 248
            |:...|...:|..|||      :|:.|.:|....||..::..:...||       .|:....:..
Human   274 RVHDGEKHFECSFCGK------SFRVHAQLTRHQKIHTDEKTYKCMECGKDFRFHSQLTEHQRIH 332

  Fly   249 AGEDVYEIV--EK----SAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHG 307
            .||..|:.:  ||    |:|....|: :.:|.:|:       .||.|||..........|.::|.
Human   333 TGEKPYKCMHCEKVFRISSQLIEHQR-IHTGEKPY-------ACKECGKAFGVCRELARHQRIHT 389

  Fly   308 TATPYVCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSI 372
            ...||.|..||:.|:..::...|..:|....|.:|..|.|.:...|.|..|..||||.||:||..
Human   390 GKKPYECKACGKVFRNSSSLTRHQRIHTGEKPYKCKECEKAFGVGSELTRHERIHSGQKPYECKE 454

  Fly   373 CGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGST 437
            |||.....|...:|...|:||||:.|.:||:.||:||.|..|:|.|:.|||:.|..|.| :|..:
Human   455 CGKFFRLTSALIQHQRIHSGEKPYECKVCGKAFRHSSALTEHQRIHTGEKPYECKACGK-AFRHS 518

  Fly   438 SELNRHMLVHSSERPFGCEQCGKSF 462
            |...:|..:|:.::|:.|::||.||
Human   519 SSFTKHQRIHTDDKPYECKECGNSF 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
zf-H2C2_2 354..379 CDD:290200 13/24 (54%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 34/85 (40%)
zf-H2C2_2 384..407 CDD:290200 10/22 (45%)
C2H2 Zn finger 398..418 CDD:275368 10/19 (53%)
C2H2 Zn finger 426..447 CDD:275368 6/20 (30%)
zf-H2C2_2 439..464 CDD:290200 8/24 (33%)
C2H2 Zn finger 455..475 CDD:275368 5/8 (63%)
ZNF529NP_001139121.1 KRAB 39..>81 CDD:214630
KRAB 39..78 CDD:279668
C2H2 Zn finger 201..221 CDD:275368
C2H2 Zn finger 256..276 CDD:275368 1/1 (100%)
C2H2 Zn finger 284..304 CDD:275368 8/25 (32%)
COG5048 294..>361 CDD:227381 15/67 (22%)
C2H2 Zn finger 312..332 CDD:275368 3/19 (16%)
zf-H2C2_2 325..347 CDD:290200 5/21 (24%)
COG5048 336..>408 CDD:227381 21/79 (27%)
C2H2 Zn finger 340..360 CDD:275368 5/20 (25%)
zf-H2C2_2 353..375 CDD:290200 8/29 (28%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
zf-H2C2_2 380..405 CDD:290200 8/24 (33%)
COG5048 <392..544 CDD:227381 60/153 (39%)
C2H2 Zn finger 396..416 CDD:275368 5/19 (26%)
zf-H2C2_2 408..431 CDD:290200 6/22 (27%)
C2H2 Zn finger 424..444 CDD:275368 6/19 (32%)
zf-H2C2_2 436..459 CDD:290200 13/22 (59%)
C2H2 Zn finger 452..472 CDD:275368 6/19 (32%)
zf-H2C2_2 464..489 CDD:290200 10/24 (42%)
C2H2 Zn finger 480..500 CDD:275368 10/19 (53%)
zf-H2C2_2 492..517 CDD:290200 11/25 (44%)
C2H2 Zn finger 508..528 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.