| Sequence 1: | NP_570028.1 | Gene: | CG2712 / 31267 | FlyBaseID: | FBgn0024975 | Length: | 501 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_024304748.1 | Gene: | ZNF705A / 440077 | HGNCID: | 32281 | Length: | 315 | Species: | Homo sapiens |
| Alignment Length: | 260 | Identity: | 75/260 - (28%) |
|---|---|---|---|
| Similarity: | 120/260 - (46%) | Gaps: | 30/260 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 205 GKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAKAGEDVYEIVEKSAQTSATQKT 269
Fly 270 LPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRNARDGHVTLH 334
Fly 335 DRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPHGCD 399
Fly 400 ICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQK--RSFGSTSELNRHMLVHSSERPFGCEQCGKSF 462
Fly 463 462 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG2712 | NP_570028.1 | zf-AD | 13..92 | CDD:214871 | |
| C2H2 Zn finger | 286..306 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 314..334 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 342..362 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 354..379 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 8/19 (42%) | ||
| COG5048 | 378..>463 | CDD:227381 | 34/87 (39%) | ||
| zf-H2C2_2 | 384..407 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 398..418 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 426..447 | CDD:275368 | 5/22 (23%) | ||
| zf-H2C2_2 | 439..464 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 455..475 | CDD:275368 | 5/8 (63%) | ||
| ZNF705A | XP_024304748.1 | KRAB | 22..81 | CDD:214630 | 2/3 (67%) |
| C2H2 Zn finger | 133..153 | CDD:275368 | 2/19 (11%) | ||
| COG5048 | <136..315 | CDD:227381 | 58/176 (33%) | ||
| C2H2 Zn finger | 162..181 | CDD:275368 | 4/18 (22%) | ||
| C2H2 Zn finger | 189..209 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 201..226 | CDD:316026 | 10/24 (42%) | ||
| C2H2 Zn finger | 217..237 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 229..254 | CDD:316026 | 11/24 (46%) | ||
| C2H2 Zn finger | 245..265 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 273..293 | CDD:275368 | 4/19 (21%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165146595 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24381 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.030 | |||||