DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and CG6808

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster


Alignment Length:463 Identity:114/463 - (24%)
Similarity:185/463 - (39%) Gaps:134/463 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ALCRVCHTASPRCLPLFKPLDDPISGKPATLAS---------ILSYCSGLEILEAELFLPHHICP 67
            ::||.|..                .|..:||.|         ::|| :|..: :.:..||..||.
  Fly     8 SMCRTCRK----------------KGTQSTLQSLFESNAHKLLISY-AGTSV-KPDDGLPDQICT 54

  Fly    68 DCVAKLRLSLEFKRSVHRMDRIL---RQSHADFCRSKKISAVNTRARLSTEIPEDFVLVLDDQEV 129
            .|:.:|          ..:||.|   :||.|.. ||                       |..|.:
  Fly    55 VCLMQL----------EEVDRFLSACKQSDAHL-RS-----------------------LVRQTL 85

  Fly   130 TEYPA-ETIRDEEQLLVVESDEAESR-----LEAPIVQEERLDI-----ALEQHEDDLCEIVDDP 183
            :...| ||:.|::||      |.:.|     :...:::|..::.     |||..:||  ||:   
  Fly    86 SSASAFETLEDKDQL------EQKKRARKQNISGRLIEENPINFKTQENALETTKDD--EIL--- 139

  Fly   184 DPEQRRSRLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAK 248
                              ||  .:.:....|..::....:..|.||  |:.|.: :.::..:..:
  Fly   140 ------------------PI--NKFSSDFVFDLNVNAENEKDIHQE--DYTISD-MDLDREISDQ 181

  Fly   249 AGEDVYEIVEKSAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATP-- 311
            ...:.|. .|.||.|.:.|:|    |..:..|.||..               |.:.|.....|  
  Fly   182 NYSETYS-QESSAATDSIQET----SEDYHNLEPSAD---------------YVIDLGVACEPDK 226

  Fly   312 YVCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKR 376
            |.|.||..:::..:..:.|..:|.:...::|..|.|.:|.|.:|:||:..|:|.||::|..|.:|
  Fly   227 YRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYCSRR 291

  Fly   377 LTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELN 441
            ....|.::||...||.|:|:.|:|||:.|..||:..||...||.||.|.|.:| |:.|....:|.
  Fly   292 FADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMC-KKEFRLKHQLT 355

  Fly   442 RH--MLVH 447
            .|  .|.|
  Fly   356 AHEKSLAH 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871 19/90 (21%)
C2H2 Zn finger 286..306 CDD:275368 1/19 (5%)
C2H2 Zn finger 314..334 CDD:275368 4/19 (21%)
C2H2 Zn finger 342..362 CDD:275368 8/19 (42%)
zf-H2C2_2 354..379 CDD:290200 10/24 (42%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 29/72 (40%)
zf-H2C2_2 384..407 CDD:290200 11/22 (50%)
C2H2 Zn finger 398..418 CDD:275368 9/19 (47%)
C2H2 Zn finger 426..447 CDD:275368 7/22 (32%)
zf-H2C2_2 439..464 CDD:290200 4/11 (36%)
C2H2 Zn finger 455..475 CDD:275368
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 22/98 (22%)
C2H2 Zn finger 229..249 CDD:275368 4/19 (21%)
zf-C2H2 255..277 CDD:278523 8/21 (38%)
C2H2 Zn finger 257..277 CDD:275368 8/19 (42%)
zf-H2C2_2 269..293 CDD:290200 10/23 (43%)
C2H2 Zn finger 285..305 CDD:275368 6/19 (32%)
zf-H2C2_2 299..321 CDD:290200 10/21 (48%)
C2H2 Zn finger 313..333 CDD:275368 9/19 (47%)
C2H2 Zn finger 341..359 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.