DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and Phs

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_648789.3 Gene:Phs / 39697 FlyBaseID:FBgn0036522 Length:971 Species:Drosophila melanogaster


Alignment Length:406 Identity:103/406 - (25%)
Similarity:179/406 - (44%) Gaps:49/406 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NTRARLSTEIPEDFVLVLDDQEVTEYPAETIRDEEQLLVVESDEAESRLEAPIVQEERLDIALEQ 171
            ||.:....|...|..|.:|:........:...:::||...|::..:|::...:.|:..::.| :.
  Fly   452 NTESVALKETIHDKQLTIDEAGKAGTQKDDNSNQKQLDKSEANAGKSKMVDQVHQQMPVESA-KD 515

  Fly   172 HEDDLCEIVDDP--DPEQRRSRLERSEPA-LQCPICGKQL--------ARKRTFQYHMRLHGQPK 225
            |:    ::.::|  ..:::|.|.||..|. :..|:..|::        .|.|..:.|:....:.|
  Fly   516 HQ----QMTEEPTNSTKRKRGRKERKSPTPVLIPLGDKEIKEEPELPERRMRKSRQHVDYVVEIK 576

  Fly   226 IRQEDNDHCIEECLQVEPVLQAKAGEDVYEIVEKSAQTSATQKTLPSGSR------PWKPLNPSL 284
            ..:||:|       :||   :|:..:|....:  |...|:|.::..|..|      ....:....
  Fly   577 DEEEDDD-------EVE---EAEVDDDSSATI--SPHNSSTDESFTSIKRESSEESQHNGIGGIH 629

  Fly   285 QCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVY 349
            .|..|||.....:..:.|::||....||||..||.:|:.:.....|...|......:|..|....
  Fly   630 TCNFCGKTFKRFSRMQDHLRLHTGEKPYVCGQCGRAFRLKMRLVEHQLRHRAEKAYKCDICSMPL 694

  Fly   350 RQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAH 414
            .....|..|:..|...:.::|..|.|...:.|....|:..||||||:.||:||:.||...||:.|
  Fly   695 ATKQDLSLHMRHHKNDRRYKCDKCNKGFVRSSDLSIHVRIHTGEKPYSCDLCGKAFRARQNLVVH 759

  Fly   415 KRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRISLAIHRQSHKAGR 479
            :|.|..:||..|.:|.|| |....::..||..|:.|:|:.|:.|.:.:..|::|..|:       
  Fly   760 RRTHLGDKPIQCELCDKR-FARKIDMRVHMRRHTGEKPYNCDACQRGYSSRVNLLRHQ------- 816

  Fly   480 QRRRAEHEVGVQLEEQ 495
                 |.|.|:  |||
  Fly   817 -----EREHGI--EEQ 825

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 4/19 (21%)
zf-H2C2_2 354..379 CDD:290200 6/24 (25%)
C2H2 Zn finger 370..390 CDD:275368 5/19 (26%)
COG5048 378..>463 CDD:227381 33/84 (39%)
zf-H2C2_2 384..407 CDD:290200 12/22 (55%)
C2H2 Zn finger 398..418 CDD:275368 10/19 (53%)
C2H2 Zn finger 426..447 CDD:275368 7/20 (35%)
zf-H2C2_2 439..464 CDD:290200 7/24 (29%)
C2H2 Zn finger 455..475 CDD:275368 5/19 (26%)
PhsNP_648789.3 COG5048 <594..787 CDD:227381 55/195 (28%)
C2H2 Zn finger 631..651 CDD:275368 5/19 (26%)
zf-H2C2_2 644..666 CDD:290200 9/21 (43%)
zf-H2C2_2 699..724 CDD:290200 6/24 (25%)
zf-C2H2 713..735 CDD:278523 5/21 (24%)
C2H2 Zn finger 715..735 CDD:275368 5/19 (26%)
zf-H2C2_2 727..750 CDD:290200 11/22 (50%)
C2H2 Zn finger 743..763 CDD:275368 10/19 (53%)
zf-H2C2_2 755..780 CDD:290200 12/25 (48%)
C2H2 Zn finger 771..791 CDD:275368 7/20 (35%)
zf-H2C2_2 783..808 CDD:290200 7/24 (29%)
C2H2 Zn finger 799..816 CDD:275370 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471558
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.