DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and sens-2

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001285692.1 Gene:sens-2 / 33957 FlyBaseID:FBgn0051632 Length:746 Species:Drosophila melanogaster


Alignment Length:476 Identity:107/476 - (22%)
Similarity:171/476 - (35%) Gaps:146/476 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RSVHRMDRILRQSHADFCRSKKISAVNTRARLSTEIPEDFVLVLDDQEVTEYPAETIRDEEQLLV 145
            ||:|...|         .||:..|...:|:..|:...|                         |.
  Fly   258 RSLHSRSR---------SRSRSRSHSRSRSHSSSSSVE-------------------------LE 288

  Fly   146 VESDEAESRLEAP----------IVQEERLDIALEQHEDDLCEIV-----DDPDPEQRRSR---- 191
            |:|.....|:.:|          ::.......::...:.||..:.     |:|.|::|..|    
  Fly   289 VDSPPGSPRISSPSGASASASELLITANGGGRSIGSKKSDLFSVSALLRRDEPPPQRRTPRSPPL 353

  Fly   192 -----------------LERSEP------ALQCPICGKQLARKRTFQYHMRLHGQPKIRQE---- 229
                             :.:..|      ..|.|:....|.......:|.....|.:.:|:    
  Fly   354 GHLTSSGLAMPFNPLEAMRQGYPPNYDAAMFQRPLFSPALPFFAAVAFHQGQQQQQQQQQQQSGL 418

  Fly   230 ------DNDHCIEECLQVEPVLQAKAGEDVYEIVEKSAQTSATQKTL---------PSGSRPWKP 279
                  |:...:.....:...||: ||::.......:|..:|....:         |:|.....|
  Fly   419 AAGYHPDSQENLFRLRSLMVPLQS-AGQNNSSAAAAAAAAAAAAVGVGVGVGVGVPPNGGHLGLP 482

  Fly   280 LNPSL--------------------QCKICGKQLSTNNSFKYH-MQLHGTATPYVCTICGESFKT 323
            .:|.|                    .|..|.|..||.:..:.| .:.|....||.|.:|.::|..
  Fly   483 HSPHLHHFHHMAAKWPGLHQFSDLYSCMKCEKMFSTPHGLEVHSRRTHHGKKPYACELCNKTFGH 547

  Fly   324 RNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHML 388
            ..:...|..:|:......|..|.|.::::|:|.|||||||..:|:.|:.||||..|||..|||..
  Fly   548 EVSLSQHRAVHNVEKVFECKQCGKRFKRSSTLSTHLLIHSDTRPYPCNYCGKRFHQKSDMKKHTY 612

  Fly   389 THTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERPF 453
            .|||||||.|.:||:.|..|||||.|.|                             .|:..:||
  Fly   613 IHTGEKPHKCQVCGKAFSQSSNLITHSR-----------------------------KHTGYKPF 648

  Fly   454 GCEQCGKSFKRRISLAIHRQS 474
            .|:.|.|:|:|::.|..|:::
  Fly   649 SCKLCHKAFQRKVDLRRHKET 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871 4/10 (40%)
C2H2 Zn finger 286..306 CDD:275368 6/20 (30%)
C2H2 Zn finger 314..334 CDD:275368 4/19 (21%)
C2H2 Zn finger 342..362 CDD:275368 9/19 (47%)
zf-H2C2_2 354..379 CDD:290200 14/24 (58%)
C2H2 Zn finger 370..390 CDD:275368 11/19 (58%)
COG5048 378..>463 CDD:227381 30/84 (36%)
zf-H2C2_2 384..407 CDD:290200 14/22 (64%)
C2H2 Zn finger 398..418 CDD:275368 11/19 (58%)
C2H2 Zn finger 426..447 CDD:275368 0/20 (0%)
zf-H2C2_2 439..464 CDD:290200 7/24 (29%)
C2H2 Zn finger 455..475 CDD:275368 7/20 (35%)
sens-2NP_001285692.1 COG5048 <504..672 CDD:227381 66/195 (34%)
C2H2 Zn finger 509..530 CDD:275368 6/20 (30%)
zf-H2C2_2 522..545 CDD:290200 6/22 (27%)
C2H2 Zn finger 538..558 CDD:275368 4/19 (21%)
zf-H2C2_2 550..575 CDD:290200 5/24 (21%)
C2H2 Zn finger 566..586 CDD:275368 9/19 (47%)
zf-H2C2_2 579..603 CDD:290200 14/23 (61%)
C2H2 Zn finger 594..614 CDD:275368 11/19 (58%)
zf-H2C2_2 606..631 CDD:290200 14/24 (58%)
C2H2 Zn finger 622..642 CDD:275368 11/48 (23%)
zf-H2C2_2 634..657 CDD:290200 11/51 (22%)
C2H2 Zn finger 650..677 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.