DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and RGD1566386

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_038945325.1 Gene:RGD1566386 / 304336 RGDID:1566386 Length:707 Species:Rattus norvegicus


Alignment Length:417 Identity:110/417 - (26%)
Similarity:168/417 - (40%) Gaps:88/417 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 QSHAD----FCRSKKISAVNTRARLSTEIPEDFVLVLDDQEVTEYPAETIRDEEQLLVVESDEA- 151
            |:|.:    ||...::..|:.:.....:|.|           .:...:|...|.:.:..:...| 
  Rat   337 QAHKENIKFFCLDAELQTVDQKLHREKQIYE-----------CKVSGKTFCHESENISQQKPHAW 390

  Fly   152 -------ESRLEAPIVQEERLD-IALEQHEDDLCEIVDDPDPEQRRSRLERSEPALQCPICGKQL 208
                   |||       |.|.| .||.||:                 ||...|.|.:...|.|..
  Rat   391 EKACGGKESR-------ETRCDESALTQHQ-----------------RLYTEEKACEGRKCSKAF 431

  Fly   209 ARKRTFQYHMRLHGQPKIRQEDNDHCIE---ECLQVEPV---------------LQAKAG-EDVY 254
                   ||..|     :.|....|..|   :|.::..:               |:...| .|..
  Rat   432 -------YHNSL-----LSQYQTAHTTEQQSDCKELMKIYFYISSLTQHHRPHTLEKPYGCNDCM 484

  Fly   255 EIVEKSAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGE 319
            :.....:|.:..|:| .:|.:|.       :||.|.|.....:....|..:|....||.|..|.:
  Rat   485 KTFSHKSQLARHQRT-HTGEKPH-------ECKECRKAFCHKSHLTRHQGIHAPEKPYECKECKK 541

  Fly   320 SFKTRNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYK 384
            ||..|:....|...|....|..|..|.|.:.:.|.|..|..||:|.||.:|..||....:||...
  Rat   542 SFYLRSQLTQHQRTHTGEKPFECKECQKAFFRNSHLTQHQKIHTGEKPHKCKECGNAFARKSHLT 606

  Fly   385 KHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSS 449
            :|..|||||:|:.|..|.:.|...|.|:.|:..|:.|:.:.|..|:| :|...:.|.||.::|.|
  Rat   607 QHQKTHTGERPYECKECRKAFSRKSQLMQHETTHTGERAYECKECRK-TFYLKAYLTRHQVIHKS 670

  Fly   450 ERPFGCEQCGKSFKRRISLAIHRQSHK 476
            |:||.|::|||:|.|:..|..|:::||
  Rat   671 EKPFECKKCGKAFSRKSYLTRHQKTHK 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871 110/417 (26%)
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 6/19 (32%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
zf-H2C2_2 354..379 CDD:290200 10/24 (42%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 33/84 (39%)
zf-H2C2_2 384..407 CDD:290200 10/22 (45%)
C2H2 Zn finger 398..418 CDD:275368 6/19 (32%)
C2H2 Zn finger 426..447 CDD:275368 7/20 (35%)
zf-H2C2_2 439..464 CDD:290200 13/24 (54%)
C2H2 Zn finger 455..475 CDD:275368 8/19 (42%)
RGD1566386XP_038945325.1 C2H2 Zn finger 536..556 CDD:275368 6/19 (32%)
C2H2 Zn finger 564..584 CDD:275368 6/19 (32%)
C2H2 Zn finger 592..612 CDD:275368 6/19 (32%)
C2H2 Zn finger 620..640 CDD:275368 6/19 (32%)
C2H2 Zn finger 648..668 CDD:275368 7/20 (35%)
C2H2 Zn finger 676..696 CDD:275368 8/19 (42%)
KRAB 43..102 CDD:214630
COG5048 <425..697 CDD:227381 84/292 (29%)
C2H2 Zn finger 427..444 CDD:275368 6/28 (21%)
C2H2 Zn finger 452..472 CDD:275368 1/19 (5%)
C2H2 Zn finger 480..500 CDD:275368 4/20 (20%)
C2H2 Zn finger 508..528 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.