| Sequence 1: | NP_570028.1 | Gene: | CG2712 / 31267 | FlyBaseID: | FBgn0024975 | Length: | 501 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001012771.1 | Gene: | ZNF763 / 284390 | HGNCID: | 27614 | Length: | 397 | Species: | Homo sapiens |
| Alignment Length: | 339 | Identity: | 96/339 - (28%) |
|---|---|---|---|
| Similarity: | 134/339 - (39%) | Gaps: | 70/339 - (20%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 170 EQHEDDLCEIVDDPDPEQRRSRLER--SEPALQCP--ICG------------------------- 205
Fly 206 -------KQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAKAGEDVYEIVE----- 258
Fly 259 KSAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKT 323
Fly 324 RNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHML 388
Fly 389 THTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERPF 453
Fly 454 GCEQCGKSFKRRIS 467 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG2712 | NP_570028.1 | zf-AD | 13..92 | CDD:214871 | |
| C2H2 Zn finger | 286..306 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 314..334 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 342..362 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 354..379 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 370..390 | CDD:275368 | 5/19 (26%) | ||
| COG5048 | 378..>463 | CDD:227381 | 35/84 (42%) | ||
| zf-H2C2_2 | 384..407 | CDD:290200 | 11/22 (50%) | ||
| C2H2 Zn finger | 398..418 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 426..447 | CDD:275368 | 8/20 (40%) | ||
| zf-H2C2_2 | 439..464 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 455..475 | CDD:275368 | 6/13 (46%) | ||
| ZNF763 | NP_001012771.1 | KRAB | 7..>49 | CDD:214630 | |
| KRAB | 7..46 | CDD:279668 | |||
| C2H2 Zn finger | 149..169 | CDD:275368 | 6/25 (24%) | ||
| COG5048 | 202..>390 | CDD:227381 | 69/192 (36%) | ||
| C2H2 Zn finger | 205..225 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 221..242 | CDD:290200 | 8/20 (40%) | ||
| C2H2 Zn finger | 233..253 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 247..270 | CDD:290200 | 6/22 (27%) | ||
| C2H2 Zn finger | 261..281 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 273..297 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 289..309 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 301..326 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 317..337 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 332..354 | CDD:290200 | 11/22 (50%) | ||
| DUF45 | <342..383 | CDD:302795 | 17/41 (41%) | ||
| C2H2 Zn finger | 345..365 | CDD:275368 | 8/20 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165146610 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||