DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and AU041133

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001156536.1 Gene:AU041133 / 216177 MGIID:2143755 Length:498 Species:Mus musculus


Alignment Length:297 Identity:96/297 - (32%)
Similarity:140/297 - (47%) Gaps:18/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 QRRSRLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAK--- 248
            ::..:....|...:|..|||....:.:.|.|.|.|...|  ..|.:.|.:.......:|..|   
Mouse   122 RKHEKKHTKEKLYECNHCGKSFPSRNSLQIHNRTHTGEK--PYDCNECGKAFTCSSNLLLHKRTH 184

  Fly   249 AGEDVYEIVE-----KSAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGT 308
            .||..|:..:     .|:......|...:|.:|:       .|..|||..:.:|:.:.|.:.|..
Mouse   185 TGEKPYDCSDCGKAFASSSNLQIHKRKHTGEKPY-------GCNQCGKAFAYSNALQKHERSHTR 242

  Fly   309 ATPYVCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSIC 373
            ...|.|..||::|....:...|...|....|..|..|.|.:..:|:|..|...|:|.|||:|:.|
Mouse   243 EKIYECNQCGKAFARHRSLQNHEEHHTLEKPYECSQCGKAFAYSSNLYIHERSHTGEKPFKCTQC 307

  Fly   374 GKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTS 438
            ||.....|..:.|..|||||||:.|:.||:.|...|||:.|||.|:.|||:.|..|.| :|..:|
Mouse   308 GKAFPSHSSLQIHERTHTGEKPYDCNECGKAFACRSNLLLHKRTHTGEKPYHCIECGK-AFACSS 371

  Fly   439 ELNRHMLVHSSERPFGCEQCGKSFKRRISLAIHRQSH 475
            .|.:|...|:.|:|:.|.||||:|.||..|.||.:.|
Mouse   372 SLQKHEKTHTGEKPYECNQCGKAFARRSDLYIHERIH 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
zf-H2C2_2 354..379 CDD:290200 11/24 (46%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 38/84 (45%)
zf-H2C2_2 384..407 CDD:290200 12/22 (55%)
C2H2 Zn finger 398..418 CDD:275368 10/19 (53%)
C2H2 Zn finger 426..447 CDD:275368 7/20 (35%)
zf-H2C2_2 439..464 CDD:290200 11/24 (46%)
C2H2 Zn finger 455..475 CDD:275368 11/19 (58%)
AU041133NP_001156536.1 KRAB 4..>47 CDD:214630
KRAB 4..43 CDD:279668
COG5048 104..489 CDD:227381 96/297 (32%)
C2H2 Zn finger 108..128 CDD:275368 0/5 (0%)
C2H2 Zn finger 136..156 CDD:275368 7/19 (37%)
zf-H2C2_2 148..173 CDD:290200 7/26 (27%)
C2H2 Zn finger 164..184 CDD:275368 3/19 (16%)
zf-H2C2_2 176..201 CDD:290200 5/24 (21%)
C2H2 Zn finger 192..212 CDD:275368 2/19 (11%)
zf-H2C2_2 204..229 CDD:290200 7/31 (23%)
C2H2 Zn finger 220..240 CDD:275368 6/19 (32%)
zf-H2C2_2 232..257 CDD:290200 7/24 (29%)
C2H2 Zn finger 248..268 CDD:275368 5/19 (26%)
C2H2 Zn finger 276..296 CDD:275368 6/19 (32%)
zf-H2C2_2 288..311 CDD:290200 11/22 (50%)
C2H2 Zn finger 304..324 CDD:275368 6/19 (32%)
zf-H2C2_2 316..341 CDD:290200 12/24 (50%)
C2H2 Zn finger 332..352 CDD:275368 10/19 (53%)
zf-H2C2_2 344..369 CDD:290200 13/25 (52%)
C2H2 Zn finger 360..380 CDD:275368 7/20 (35%)
zf-H2C2_2 372..397 CDD:290200 11/24 (46%)
C2H2 Zn finger 388..408 CDD:275368 11/19 (58%)
zf-H2C2_2 400..425 CDD:290200 4/9 (44%)
C2H2 Zn finger 416..436 CDD:275368
zf-H2C2_2 428..453 CDD:290200
C2H2 Zn finger 444..464 CDD:275368
zf-H2C2_2 456..481 CDD:290200
C2H2 Zn finger 472..492 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.