DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF778

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001188336.1 Gene:ZNF778 / 197320 HGNCID:26479 Length:757 Species:Homo sapiens


Alignment Length:297 Identity:99/297 - (33%)
Similarity:136/297 - (45%) Gaps:46/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 RRSRLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAKAGED 252
            |..|....|....|..|||..........|:|.|                           .||.
Human   438 RHVRTHTGEKPYTCKDCGKAFCTSSGLTEHVRTH---------------------------TGEK 475

  Fly   253 VYEIVE--KSAQTSAT---QKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPY 312
            .||..:  ||...|::   ...:.:|.:|:       :||.|||..:..:....||:.|....||
Human   476 PYECKDCGKSFTVSSSLTEHARIHTGEKPY-------ECKQCGKAFTGRSGLTKHMRTHTGEKPY 533

  Fly   313 VCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRL 377
            .|..||:::......:.||..|....|..|..|.|.:|.:|.|..|:.||:||||:||..|||..
Human   534 ECKDCGKAYNRVYLLNEHVKTHTEEKPFICTVCRKSFRNSSCLNKHIQIHTGIKPYECKDCGKTF 598

  Fly   378 TQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNR 442
            |..|...:|:.|||||||:.|.:||:.|..||:||.|.|.|:.|||:.|..|.| :|.|:|.|..
Human   599 TVSSSLTEHIRTHTGEKPYECKVCGKAFTTSSHLIVHIRTHTGEKPYICKECGK-AFASSSHLIE 662

  Fly   443 HMLVHSSERPFGCEQCGKSFKRRISLAIHRQSHKAGR 479
            |...|:.|:|:.|.:|||:|:....|      ||.||
Human   663 HRRTHTGEKPYICNECGKAFRASSHL------HKHGR 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 7/19 (37%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 7/19 (37%)
zf-H2C2_2 354..379 CDD:290200 13/24 (54%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
COG5048 378..>463 CDD:227381 39/84 (46%)
zf-H2C2_2 384..407 CDD:290200 12/22 (55%)
C2H2 Zn finger 398..418 CDD:275368 10/19 (53%)
C2H2 Zn finger 426..447 CDD:275368 8/20 (40%)
zf-H2C2_2 439..464 CDD:290200 10/24 (42%)
C2H2 Zn finger 455..475 CDD:275368 6/19 (32%)
ZNF778NP_001188336.1 KRAB 42..100 CDD:214630
C2H2 Zn finger 283..303 CDD:275368
C2H2 Zn finger 311..331 CDD:275368
C2H2 Zn finger 339..358 CDD:275368
C2H2 Zn finger 367..387 CDD:275368
COG5048 380..747 CDD:227381 99/297 (33%)
C2H2 Zn finger 395..415 CDD:275368
C2H2 Zn finger 423..443 CDD:275368 2/4 (50%)
C2H2 Zn finger 451..471 CDD:275368 6/19 (32%)
C2H2 Zn finger 479..499 CDD:275368 3/19 (16%)
C2H2 Zn finger 507..527 CDD:275368 7/19 (37%)
C2H2 Zn finger 535..555 CDD:275368 5/19 (26%)
C2H2 Zn finger 563..583 CDD:275368 7/19 (37%)
C2H2 Zn finger 591..611 CDD:275368 7/19 (37%)
C2H2 Zn finger 619..639 CDD:275368 10/19 (53%)
C2H2 Zn finger 647..667 CDD:275368 8/20 (40%)
C2H2 Zn finger 675..695 CDD:275368 10/25 (40%)
C2H2 Zn finger 703..722 CDD:275368
C2H2 Zn finger 731..751 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.