DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF596

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001035880.1 Gene:ZNF596 / 169270 HGNCID:27268 Length:504 Species:Homo sapiens


Alignment Length:294 Identity:87/294 - (29%)
Similarity:140/294 - (47%) Gaps:40/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 QRRSRLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIR-----QEDNDHCIEECLQVEPVLQ 246
            ::..|....|....|.:|||..::....:.|..:|.:.|.:     .:...||.:          
Human   239 RKHERTHTGEKPYGCHLCGKAFSKSSNLRRHEMIHTREKAQICHLCGKAFTHCSD---------- 293

  Fly   247 AKAGEDVYEIVEKSAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATP 311
                      :.|..:|..       |.:|:       .|.:|||..|..:..:.|.:.|....|
Human   294 ----------LRKHERTHL-------GDKPY-------GCLLCGKAFSKCSYLRQHERTHNGEKP 334

  Fly   312 YVCTICGESFKTRNARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKR 376
            |.|.:||::|...:....|...|:...|:.|..|.|.:.::|.|:.|..||:|.||:||.:|||.
Human   335 YECHLCGKAFSHCSHLRQHERSHNGEKPHGCHLCGKAFTESSVLKRHERIHTGEKPYECHVCGKA 399

  Fly   377 LTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELN 441
            .|:.|..::|..|||||||:.|.:||:.|.:||.|..|:|.|:.|||:.|.:|.| :|..:....
Human   400 FTESSDLRRHERTHTGEKPYECHLCGKAFNHSSVLRRHERTHTGEKPYECNICGK-AFNRSYNFR 463

  Fly   442 RHMLVHSSERPFGCEQCGKSFKRRISLAIHRQSH 475
            .|..||:.|:|:.|..|||:|.:..:|..|.::|
Human   464 LHRRVHTGEKPYVCPLCGKAFSKFFNLRQHERTH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
zf-H2C2_2 354..379 CDD:290200 12/24 (50%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
COG5048 378..>463 CDD:227381 36/84 (43%)
zf-H2C2_2 384..407 CDD:290200 12/22 (55%)
C2H2 Zn finger 398..418 CDD:275368 9/19 (47%)
C2H2 Zn finger 426..447 CDD:275368 5/20 (25%)
zf-H2C2_2 439..464 CDD:290200 10/24 (42%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
ZNF596NP_001035880.1 KRAB 7..67 CDD:214630
KRAB 7..46 CDD:279668
C2H2 Zn finger 197..217 CDD:275368
C2H2 Zn finger 225..245 CDD:275368 1/5 (20%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
C2H2 Zn finger 281..301 CDD:275368 3/39 (8%)
C2H2 Zn finger 309..329 CDD:275368 6/19 (32%)
zf-H2C2_2 321..346 CDD:290200 8/24 (33%)
C2H2 Zn finger 337..357 CDD:275368 5/19 (26%)
COG5048 <361..502 CDD:227381 57/138 (41%)
C2H2 Zn finger 365..385 CDD:275368 6/19 (32%)
zf-H2C2_2 378..401 CDD:290200 12/22 (55%)
C2H2 Zn finger 393..413 CDD:275368 7/19 (37%)
zf-H2C2_2 405..430 CDD:290200 12/24 (50%)
C2H2 Zn finger 421..441 CDD:275368 9/19 (47%)
zf-H2C2_2 434..458 CDD:290200 11/24 (46%)
C2H2 Zn finger 449..469 CDD:275368 5/20 (25%)
zf-H2C2_2 461..485 CDD:290200 9/23 (39%)
C2H2 Zn finger 477..497 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.