Sequence 1: | NP_570028.1 | Gene: | CG2712 / 31267 | FlyBaseID: | FBgn0024975 | Length: | 501 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_689586.3 | Gene: | ZNF684 / 127396 | HGNCID: | 28418 | Length: | 378 | Species: | Homo sapiens |
Alignment Length: | 280 | Identity: | 88/280 - (31%) |
---|---|---|---|
Similarity: | 122/280 - (43%) | Gaps: | 58/280 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 196 EPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAKAGEDVYEIVEKS 260
Fly 261 AQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRN 325
Fly 326 ARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTH 390
Fly 391 TGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERPFGC 455
Fly 456 EQCGKSFKRRISLAIHRQSH 475 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2712 | NP_570028.1 | zf-AD | 13..92 | CDD:214871 | |
C2H2 Zn finger | 286..306 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 314..334 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 342..362 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 354..379 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 370..390 | CDD:275368 | 7/19 (37%) | ||
COG5048 | 378..>463 | CDD:227381 | 37/84 (44%) | ||
zf-H2C2_2 | 384..407 | CDD:290200 | 13/22 (59%) | ||
C2H2 Zn finger | 398..418 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 426..447 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 439..464 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 455..475 | CDD:275368 | 7/19 (37%) | ||
ZNF684 | NP_689586.3 | KRAB | 8..68 | CDD:214630 | |
KRAB | 8..47 | CDD:279668 | |||
C2H2 Zn finger | 161..181 | CDD:275368 | 9/30 (30%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 13/77 (17%) | ||
COG5048 | <185..345 | CDD:227381 | 61/164 (37%) | ||
zf-C2H2 | 187..209 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 201..224 | CDD:290200 | 7/22 (32%) | ||
C2H2 Zn finger | 217..237 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 230..253 | CDD:290200 | 7/22 (32%) | ||
C2H2 Zn finger | 245..265 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 273..293 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 285..308 | CDD:290200 | 12/22 (55%) | ||
C2H2 Zn finger | 301..321 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 314..336 | CDD:290200 | 10/22 (45%) | ||
COG5048 | 325..>378 | CDD:227381 | 21/54 (39%) | ||
C2H2 Zn finger | 329..349 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 341..366 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165146733 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |