DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF684

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_689586.3 Gene:ZNF684 / 127396 HGNCID:28418 Length:378 Species:Homo sapiens


Alignment Length:280 Identity:88/280 - (31%)
Similarity:122/280 - (43%) Gaps:58/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 EPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAKAGEDVYEIVEKS 260
            |.|.:|..|||...:|    :|.       ||.|.|.                            
Human   156 ENAYECSECGKAFKKK----FHF-------IRHEKNH---------------------------- 181

  Fly   261 AQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRN 325
                 |:|         ||    .:|..|||..|.......|.::|....|:||..||::|..:.
Human   182 -----TRK---------KP----FECNDCGKAYSRKAHLATHQKIHNGERPFVCNDCGKAFMHKA 228

  Fly   326 ARDGHVTLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTH 390
            ....|..||....|..|..|.|.:...||...|:..|:..|.|||..|||.....|...||...|
Human   229 QLVVHQRLHTGEKPYECSQCGKTFTWNSSFNQHVKSHTLEKSFECKECGKTFRYSSSLYKHSRFH 293

  Fly   391 TGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERPFGC 455
            |||||:.|.|||:.|..:|.|:.|:|.|:.|||:.|..|.| :|...|.|.||.:.|:.|:|:.|
Human   294 TGEKPYQCIICGKAFGNTSVLVTHQRIHTGEKPYSCIECGK-AFIKKSHLLRHQITHTGEKPYEC 357

  Fly   456 EQCGKSFKRRISLAIHRQSH 475
            .:|||:|.::.:|.:|::.|
Human   358 NRCGKAFSQKSNLIVHQKIH 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
zf-H2C2_2 354..379 CDD:290200 10/24 (42%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
COG5048 378..>463 CDD:227381 37/84 (44%)
zf-H2C2_2 384..407 CDD:290200 13/22 (59%)
C2H2 Zn finger 398..418 CDD:275368 9/19 (47%)
C2H2 Zn finger 426..447 CDD:275368 8/20 (40%)
zf-H2C2_2 439..464 CDD:290200 11/24 (46%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
ZNF684NP_689586.3 KRAB 8..68 CDD:214630
KRAB 8..47 CDD:279668
C2H2 Zn finger 161..181 CDD:275368 9/30 (30%)
zf-H2C2_2 173..198 CDD:290200 13/77 (17%)
COG5048 <185..345 CDD:227381 61/164 (37%)
zf-C2H2 187..209 CDD:278523 6/21 (29%)
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
zf-H2C2_2 201..224 CDD:290200 7/22 (32%)
C2H2 Zn finger 217..237 CDD:275368 5/19 (26%)
zf-H2C2_2 230..253 CDD:290200 7/22 (32%)
C2H2 Zn finger 245..265 CDD:275368 6/19 (32%)
C2H2 Zn finger 273..293 CDD:275368 7/19 (37%)
zf-H2C2_2 285..308 CDD:290200 12/22 (55%)
C2H2 Zn finger 301..321 CDD:275368 9/19 (47%)
zf-H2C2_2 314..336 CDD:290200 10/22 (45%)
COG5048 325..>378 CDD:227381 21/54 (39%)
C2H2 Zn finger 329..349 CDD:275368 8/20 (40%)
zf-H2C2_2 341..366 CDD:290200 11/24 (46%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146733
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.