DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and Gm45871

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001349294.1 Gene:Gm45871 / 108168395 MGIID:5804986 Length:540 Species:Mus musculus


Alignment Length:396 Identity:110/396 - (27%)
Similarity:158/396 - (39%) Gaps:75/396 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 YPA--ETIRDEEQLLV-VESDEAESRLEAPIVQEERLDIALEQHEDD---LCEIVDDPDPE---- 186
            ||.  |.|...|:... |:.|||       :|....|......|..:   .|:..|....:    
Mouse    90 YPQRHERIHTREKSYEGVQYDEA-------LVHHSNLQTHKRTHPKEKPYKCDQCDKAYSQHSHL 147

  Fly   187 QRRSRLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEEC---------LQVE 242
            ||..|....|...:|..|||      .|.||..|....:|...:..:...:|         |:|.
Mouse   148 QRHKRKHTGEKPYECKQCGK------AFAYHSELQSHERIHTGEKPYKCNQCGKAFAHHCNLRVH 206

  Fly   243 PVLQAKAGEDVYEI--------------VEKSAQTS-------------------ATQKTLPSGS 274
            .::.  .||..|:.              :.||..|.                   ...||..:|.
Mouse   207 KIIH--TGEKPYKCNQCDKAYSQHCNLQIHKSTHTGEKSYKCNQCGKAFVYYGYLQRHKTTHTGE 269

  Fly   275 RPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRNARDGHVTLHDRNNP 339
            :|:|       |.:|||..:::...:.|...|....|:.|..||::|...:....|...|....|
Mouse   270 KPYK-------CNLCGKAFASHRYLQVHKSTHTGEKPHECNQCGKAFVYHDHLQIHKRTHTGEKP 327

  Fly   340 NRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRR 404
            ..|..|.|.:.....|:.|...|:|.||:||:.|||.....|..:.|..|||||||:.|..|.:.
Mouse   328 YECNHCGKTFAAHRYLQVHKRTHTGEKPYECNQCGKAFASHSYLQVHKRTHTGEKPYECSQCDKA 392

  Fly   405 FRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRISLA 469
            |.|...|..|||.|:.|||:.|..|.| :|...:.|.||..:|:.|:|:.|.:|||:|....||.
Mouse   393 FAYPGYLQVHKRTHTGEKPYECNQCGK-AFAGQNVLKRHEKIHTGEKPYICNECGKAFVSNTSLQ 456

  Fly   470 IHRQSH 475
            ||:.:|
Mouse   457 IHKATH 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 5/19 (26%)
zf-H2C2_2 354..379 CDD:290200 11/24 (46%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 35/84 (42%)
zf-H2C2_2 384..407 CDD:290200 11/22 (50%)
C2H2 Zn finger 398..418 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..447 CDD:275368 7/20 (35%)
zf-H2C2_2 439..464 CDD:290200 11/24 (46%)
C2H2 Zn finger 455..475 CDD:275368 9/19 (47%)
Gm45871NP_001349294.1 KRAB 4..44 CDD:307490
C2H2 Zn finger 77..98 CDD:275368 3/7 (43%)
COG5048 116..538 CDD:227381 100/363 (28%)
C2H2 Zn finger 134..154 CDD:275368 5/19 (26%)
C2H2 Zn finger 162..182 CDD:275368 8/25 (32%)
C2H2 Zn finger 190..210 CDD:275368 3/19 (16%)
C2H2 Zn finger 218..238 CDD:275368 2/19 (11%)
C2H2 Zn finger 246..266 CDD:275368 2/19 (11%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
C2H2 Zn finger 302..322 CDD:275368 5/19 (26%)
C2H2 Zn finger 330..350 CDD:275368 5/19 (26%)
C2H2 Zn finger 358..378 CDD:275368 6/19 (32%)
C2H2 Zn finger 386..406 CDD:275368 8/19 (42%)
C2H2 Zn finger 414..434 CDD:275368 7/20 (35%)
C2H2 Zn finger 442..462 CDD:275368 9/19 (47%)
C2H2 Zn finger 470..490 CDD:275368
C2H2 Zn finger 498..518 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.