DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and Zfp120

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_851783.2 Gene:Zfp120 / 104348 MGIID:1345179 Length:436 Species:Mus musculus


Alignment Length:293 Identity:87/293 - (29%)
Similarity:125/293 - (42%) Gaps:68/293 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 QRRSRLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAKAGE 251
            |||:.:  .|...:|..|||..|.....|.|.|.|                              
Mouse   146 QRRTHV--VEKPYECNQCGKAFAYHSYLQRHERSH------------------------------ 178

  Fly   252 DVYEIVEKSAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTI 316
                                :|.:|:       :|..|||....::..:.|.::|.....|.|..
Mouse   179 --------------------TGEKPY-------ECNQCGKAFGRHSHLQRHERIHTGEKSYDCNQ 216

  Fly   317 CGESFKTRNARDGHVTLHDRNN----PNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRL 377
            ||::|    ....|:.:|.|.:    |..|..|.|.:.:.|.|..|..||:|.||:||..|||..
Mouse   217 CGKTF----VHHSHLQIHKRTHIGEKPFECNQCGKAFARNSHLLIHKRIHTGEKPYECKQCGKAF 277

  Fly   378 TQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNR 442
            ..:||...|...:|.||.:.|:.||:.|...::|..|||.|:.|||:.|..|.| :||..|.|.|
Mouse   278 AYQSGLLYHKRRYTVEKLYECNQCGKAFACHNSLQVHKRTHTGEKPYKCNQCGK-AFGRYSSLQR 341

  Fly   443 HMLVHSSERPFGCEQCGKSFKRRISLAIHRQSH 475
            |..:|:.|:|:.|:||||:|.|..||..|.:.|
Mouse   342 HERIHTGEKPYECKQCGKAFGRHSSLQRHERIH 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 5/19 (26%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
zf-H2C2_2 354..379 CDD:290200 12/24 (50%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
COG5048 378..>463 CDD:227381 35/84 (42%)
zf-H2C2_2 384..407 CDD:290200 8/22 (36%)
C2H2 Zn finger 398..418 CDD:275368 8/19 (42%)
C2H2 Zn finger 426..447 CDD:275368 9/20 (45%)
zf-H2C2_2 439..464 CDD:290200 12/24 (50%)
C2H2 Zn finger 455..475 CDD:275368 10/19 (53%)
Zfp120NP_851783.2 KRAB 28..>69 CDD:214630
KRAB 28..67 CDD:279668
C2H2 Zn finger 102..122 CDD:275368
COG5048 <140..387 CDD:227381 87/293 (30%)
C2H2 Zn finger 158..178 CDD:275368 8/19 (42%)
zf-H2C2_2 170..195 CDD:290200 10/81 (12%)
C2H2 Zn finger 186..206 CDD:275368 5/19 (26%)
zf-H2C2_2 198..223 CDD:290200 7/28 (25%)
C2H2 Zn finger 214..234 CDD:275368 7/23 (30%)
zf-H2C2_2 226..251 CDD:290200 7/24 (29%)
C2H2 Zn finger 242..262 CDD:275368 6/19 (32%)
zf-H2C2_2 254..279 CDD:290200 12/24 (50%)
C2H2 Zn finger 270..288 CDD:275368 7/17 (41%)
C2H2 Zn finger 298..318 CDD:275368 8/19 (42%)
zf-H2C2_2 310..335 CDD:290200 12/25 (48%)
C2H2 Zn finger 326..346 CDD:275368 9/20 (45%)
zf-H2C2_2 338..363 CDD:290200 12/24 (50%)
C2H2 Zn finger 354..374 CDD:275368 10/19 (53%)
C2H2 Zn finger 410..430 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.