DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and LOC102554315

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_006235251.1 Gene:LOC102554315 / 102554315 RGDID:7747897 Length:435 Species:Rattus norvegicus


Alignment Length:325 Identity:95/325 - (29%)
Similarity:135/325 - (41%) Gaps:74/325 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 QRRSRLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAKAGE 251
            ||..|....|...||..|||...|....|.|.|:|                           .||
  Rat   171 QRHERSHTGEKPYQCNQCGKAFGRHSHLQRHERIH---------------------------TGE 208

  Fly   252 DVYEIVEKSAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTI 316
            ..|:                              |..|||....::..:.|.:.|....|:.|..
  Rat   209 KSYD------------------------------CNQCGKTFVHHSHLQIHKRTHIGEKPFECNQ 243

  Fly   317 CGESFKTRNARDGHVTLHDR----NNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRL 377
            ||::|    ||:.|:.:|.|    ..|..|..|.|.:...|.|..|...::..||:|||.|||..
  Rat   244 CGKAF----ARNSHLLIHKRIHTGEKPYACKQCGKAFAYQSGLLYHKRRYTVEKPYECSQCGKAF 304

  Fly   378 TQKSGYKKHMLTHTGEKPHGCDICGRRF-RYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELN 441
            ...:..:.|..|||||||:.|:.||:.| |||| |..|:|.|:.|||:.|..|.| :||..|.|.
  Rat   305 VCHNSLQVHKRTHTGEKPYKCNQCGKAFGRYSS-LQRHERIHTGEKPYECNQCGK-AFGRHSSLQ 367

  Fly   442 RHMLVHSSERPFGCEQCGKSFKRRISLAIHRQSHKAGRQRRRAEHEVG------VQLEEQDENVE 500
            ||..:|:.::|.||.||.|.::...||.:|.:.|...:.....:.:.|      :|:.:.:..||
  Rat   368 RHERIHTGQKPDGCSQCCKDYECYSSLRMHERPHTGEKHFECNQCDKGFSQNSNIQIHKNENIVE 432

  Fly   501  500
              Rat   433  432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
zf-H2C2_2 354..379 CDD:290200 10/24 (42%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 39/85 (46%)
zf-H2C2_2 384..407 CDD:290200 12/23 (52%)
C2H2 Zn finger 398..418 CDD:275368 11/20 (55%)
C2H2 Zn finger 426..447 CDD:275368 9/20 (45%)
zf-H2C2_2 439..464 CDD:290200 10/24 (42%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
LOC102554315XP_006235251.1 KRAB 28..>69 CDD:214630
KRAB 28..67 CDD:279668
COG5048 <51..362 CDD:227381 75/253 (30%)
C2H2 Zn finger 101..121 CDD:275368
zf-H2C2_2 141..166 CDD:290200
C2H2 Zn finger 157..177 CDD:275368 3/5 (60%)
zf-H2C2_2 169..194 CDD:290200 9/22 (41%)
C2H2 Zn finger 185..205 CDD:275368 8/19 (42%)
zf-H2C2_2 197..222 CDD:290200 11/81 (14%)
C2H2 Zn finger 213..233 CDD:275368 5/19 (26%)
zf-H2C2_2 225..250 CDD:290200 7/28 (25%)
C2H2 Zn finger 241..261 CDD:275368 9/23 (39%)
zf-H2C2_2 253..278 CDD:290200 7/24 (29%)
C2H2 Zn finger 269..287 CDD:275368 6/17 (35%)
C2H2 Zn finger 297..317 CDD:275368 6/19 (32%)
COG5048 307..>425 CDD:227381 45/119 (38%)
zf-H2C2_2 309..334 CDD:290200 12/24 (50%)
C2H2 Zn finger 325..345 CDD:275368 11/20 (55%)
zf-H2C2_2 337..362 CDD:290200 12/26 (46%)
C2H2 Zn finger 353..373 CDD:275368 9/20 (45%)
C2H2 Zn finger 409..425 CDD:275368 2/15 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.