DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and Zfp717

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:XP_008764233.1 Gene:Zfp717 / 100361503 RGDID:2319964 Length:461 Species:Rattus norvegicus


Alignment Length:469 Identity:126/469 - (26%)
Similarity:189/469 - (40%) Gaps:91/469 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LEILEAELFLPHHICPDCVAKLRLSLEFKR----------SVHRMDRILRQSHADFCRSKKISAV 106
            ||...:.:||.|     |:.|..|.|..::          ||..:..|          .|..|.|
  Rat    34 LENYRSLVFLGH-----CMVKPELILNLEQGLGPVSTAGTSVWNLSGI----------DKGNSLV 83

  Fly   107 NTRARLSTEIPEDFVLVLDDQEVTEYPAETIRDEEQLLVVESDEAESRLEAPIVQEER---LDIA 168
            :|       |.|:     |.:...:....:....|:|:     |||.::...|.|..:   .::.
  Rat    84 DT-------IQEN-----DSRHFWQIEINSRTSNEELV-----EAELKIHEEIHQGTKSYECEVC 131

  Fly   169 LE------QHEDD----LCEIVDDPDPEQRR---------------SRLERSEPALQCPICGKQL 208
            ||      |:..|    .||     :|...:               .||||.|....|..|||..
  Rat   132 LEAFYLKPQYSTDQRYHTCE-----NPYNCKKFRGAFYSKSTFRPCQRLERGEKPHACIECGKSF 191

  Fly   209 ARKRTFQYHMRLH-GQPKIRQEDNDHCIEECLQVEPVLQAKAGEDVYEIVE------KSAQTSAT 266
            ..|.....|.|.| |:......|.........|:...|:...||..||..|      :::..:..
  Rat   192 YCKSHLTVHQRTHTGEKPYECNDCKKAFYSRSQLNVHLRTHTGEKPYECKECRKTFYRNSDLTVH 256

  Fly   267 QKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGESFKTRNARDGHV 331
            |:| .:|.:|:       :||:|.|....|:....|.:.|....||.|.:|.::|..::....|.
  Rat   257 QRT-HTGEKPY-------ECKVCSKAFYCNSQLTVHHRTHTGEKPYECQVCNKAFYCKSQLAVHH 313

  Fly   332 TLHDRNNPNRCPTCFKVYRQASSLRTHLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPH 396
            ..|....|.:|..|.|.::..|.|..||..|:|.:|:.|:.|.|...:||....|..|||||||:
  Rat   314 RTHTGEKPYQCQECRKAFQCRSDLTRHLRTHTGERPYGCTECRKAFYRKSDLTVHQRTHTGEKPY 378

  Fly   397 GCDICGRRFRYSSNLIAHKRCHSQEKPHPCPVCQKRSFGSTSELNRHMLVHSSERPFGCEQCGKS 461
            .|..|.:.|..:|.|..|:|.|:.|||:.|..|.| :|....||.||...|:.|:|:.|.:|.|.
  Rat   379 ECKECRKAFYCNSQLTVHQRQHTGEKPYECKDCGK-AFQCKYELTRHHRTHTGEKPYTCMECQKG 442

  Fly   462 FKRRISLAIHRQSH 475
            |..:..|:.|.:.|
  Rat   443 FYTKSDLSRHLKIH 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871 12/49 (24%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..334 CDD:275368 4/19 (21%)
C2H2 Zn finger 342..362 CDD:275368 7/19 (37%)
zf-H2C2_2 354..379 CDD:290200 9/24 (38%)
C2H2 Zn finger 370..390 CDD:275368 6/19 (32%)
COG5048 378..>463 CDD:227381 35/84 (42%)
zf-H2C2_2 384..407 CDD:290200 11/22 (50%)
C2H2 Zn finger 398..418 CDD:275368 7/19 (37%)
C2H2 Zn finger 426..447 CDD:275368 8/20 (40%)
zf-H2C2_2 439..464 CDD:290200 11/24 (46%)
C2H2 Zn finger 455..475 CDD:275368 6/19 (32%)
Zfp717XP_008764233.1 KRAB 4..59 CDD:214630 9/29 (31%)
C2H2 Zn finger 184..204 CDD:275368 7/19 (37%)
COG5048 <194..391 CDD:227381 58/204 (28%)
C2H2 Zn finger 212..232 CDD:275368 3/19 (16%)
C2H2 Zn finger 240..260 CDD:275368 3/20 (15%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 4/19 (21%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..372 CDD:275368 6/19 (32%)
C2H2 Zn finger 380..400 CDD:275368 7/19 (37%)
zf-H2C2_2 393..415 CDD:404364 10/22 (45%)
C2H2 Zn finger 408..428 CDD:275368 8/20 (40%)
zf-H2C2_2 420..445 CDD:404364 11/24 (46%)
C2H2 Zn finger 436..456 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.