DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2712 and ZNF587B

DIOPT Version :9

Sequence 1:NP_570028.1 Gene:CG2712 / 31267 FlyBaseID:FBgn0024975 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001363152.1 Gene:ZNF587B / 100293516 HGNCID:37142 Length:633 Species:Homo sapiens


Alignment Length:314 Identity:95/314 - (30%)
Similarity:137/314 - (43%) Gaps:58/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 RLERSEPALQCPICGKQLARKRTFQYHMRLHGQPKIRQEDNDHCIEECLQVEPVLQAKAGEDVYE 255
            |:...|...:|..|.|..:||.:..||.|:|                 .:|.|.   |.||....
Human   346 RIHTGERPYKCGECEKSFSRKPSLSYHQRIH-----------------TEVRPY---KCGECGKS 390

  Fly   256 IVEKSAQTSATQKTLPSGSRPWKPLNPSLQCKICGKQLSTNNSFKYHMQLHGTATPYVCTICGES 320
            .:.|.  .....:.:.:|.||:|       |..|||..:.....:.|.::|.|..||.|..||:.
Human   391 YISKG--HLRIHQRMHTGERPYK-------CGDCGKSFNEKGHLRSHQRVHTTERPYKCGECGKC 446

  Fly   321 FK------------TRN------------ARDGHVTLHDR----NNPNRCPTCFKVYRQASSLRT 357
            |.            ||.            .:..|:.:|.|    ..|..|..|.|.:|....|..
Human   447 FSHKGNLILHQHGHTRKRPYMCWECGKLFKKKSHLLVHQRIHSGEKPYACEACQKFFRHKCHLTA 511

  Fly   358 HLLIHSGIKPFECSICGKRLTQKSGYKKHMLTHTGEKPHGCDICGRRFRYSSNLIAHKRCHSQEK 422
            |..:|:|.:|:|||.|||..|....:..|...|||:||:.|..||:.|..||.|.:|:|.|:.:|
Human   512 HQRVHTGERPYECSDCGKSFTHSCAFIVHKRVHTGQKPYECSECGKSFAASSYLTSHRRVHTGQK 576

  Fly   423 PHPCPVCQKRSFGSTSELNRHMLVHSSERPFGCEQCGKSFKRRISLAIHRQSHK 476
            |:.|..|.| ||...|.|..|..||:.|:|:||.:|.|.|::..||..|::.|:
Human   577 PYECSECGK-SFAGISSLTNHRRVHTGEKPYGCSECEKKFRKSSSLRYHQRVHE 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2712NP_570028.1 zf-AD 13..92 CDD:214871
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
C2H2 Zn finger 314..334 CDD:275368 7/43 (16%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
zf-H2C2_2 354..379 CDD:290200 11/24 (46%)
C2H2 Zn finger 370..390 CDD:275368 7/19 (37%)
COG5048 378..>463 CDD:227381 35/84 (42%)
zf-H2C2_2 384..407 CDD:290200 10/22 (45%)
C2H2 Zn finger 398..418 CDD:275368 9/19 (47%)
C2H2 Zn finger 426..447 CDD:275368 8/20 (40%)
zf-H2C2_2 439..464 CDD:290200 11/24 (46%)
C2H2 Zn finger 455..475 CDD:275368 7/19 (37%)
ZNF587BNP_001363152.1 KRAB 15..55 CDD:366587
COG5048 <215..504 CDD:227381 43/186 (23%)
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..292 CDD:275368
C2H2 Zn finger 300..320 CDD:275368
C2H2 Zn finger 328..348 CDD:275368 1/1 (100%)
C2H2 Zn finger 356..376 CDD:275368 8/19 (42%)
C2H2 Zn finger 384..404 CDD:275368 3/21 (14%)
C2H2 Zn finger 412..432 CDD:275368 5/19 (26%)
C2H2 Zn finger 440..460 CDD:275368 4/19 (21%)
C2H2 Zn finger 468..488 CDD:275368 3/19 (16%)
C2H2 Zn finger 496..516 CDD:275368 6/19 (32%)
zf-H2C2_2 508..533 CDD:372612 11/24 (46%)
C2H2 Zn finger 524..544 CDD:275368 7/19 (37%)
C2H2 Zn finger 552..572 CDD:275368 9/19 (47%)
zf-H2C2_2 564..588 CDD:372612 10/24 (42%)
COG5048 575..>628 CDD:227381 22/53 (42%)
C2H2 Zn finger 580..600 CDD:275368 8/20 (40%)
C2H2 Zn finger 608..628 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.