DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and CTDP1

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_004706.3 Gene:CTDP1 / 9150 HGNCID:2498 Length:961 Species:Homo sapiens


Alignment Length:316 Identity:70/316 - (22%)
Similarity:104/316 - (32%) Gaps:108/316 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PAAAPALFSILHTARGYSSTTKQEAGATGPNDAPEVAPNAPLLAKLFPQTSPEVDSNAEQER--- 127
            |.|||.....|  |:|.|....:.|..:.|.:|   .|.|..     |...||:....|.||   
Human   487 PKAAPEGAGAL--AQGSSLEPGRPAAPSLPGEA---EPGAHA-----PDKEPELGGQEEGERDGL 541

  Fly   128 --------KKREEEEEKENERAWKRMKLGFAIFGGSAVAAGFWAVYEFGKPEVDPNGQPIEDEFT 184
                    .::|.|.|.:|...             |.|.||         ..:|.:.:..|:|.|
Human   542 CGLGNGCADRKEAETESQNSEL-------------SGVTAG---------ESLDQSMEEEEEEDT 584

  Fly   185 HKPLVQQYLQRMWKSIH---------YYQRMIQE-PSRAKLLPDPLKPPYVQPRYTLVLEMKDVL 239
            .:.....||:.:...:|         |..:.|:| |...|::|: ||...          :.||.
Human   585 DEDDHLIYLEEILVRVHTDYYAKYDRYLNKEIEEAPDIRKIVPE-LKSKV----------LADVA 638

  Fly   240 VHPDWTYQTGWRFKKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIMYRLVRDAT 304
            :.....:.|.:..:|.....|..|..||....:|.:.          ||.|           .||
Human   639 IIFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSP----------DAPD-----------RAT 682

  Fly   305 HFVD--------------GH-HVKNLDNLNRDLKKVIVVDWDANATKMHP---DNT 342
            |.:.              || ||.|.|.|...|::     ||....::.|   |:|
Human   683 HLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLER-----WDKVEEQLFPLRDDHT 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 28/134 (21%)
CTDP1NP_004706.3 Biotinyl_lipoyl_domains 21..111 CDD:299706
FCP1_euk 177..323 CDD:131304
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..589 31/133 (23%)
BRCT 636..716 CDD:237994 22/100 (22%)
FCP1_C 716..961 CDD:286402 5/23 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 730..752 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 780..949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.