DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and NEM1

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_011867.1 Gene:NEM1 / 856393 SGDID:S000001046 Length:446 Species:Saccharomyces cerevisiae


Alignment Length:202 Identity:52/202 - (25%)
Similarity:90/202 - (44%) Gaps:39/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 LLPDPLKPPYV---QPRYTLVLEMKDVLVHP---DWTY------------------QTGWRFKKR 255
            |.|..|.|..|   |.:..||:::.:.|:|.   ..|:                  :|.:...||
Yeast   235 LFPKKLIPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYFIHKR 299

  Fly   256 PGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALD---PNGYI--MYR---LVRDATHFV-DGHH 311
            |..|.||.:.:|.:::::|||.......|::|.|:   |:.:.  .||   ::||...:: |...
Yeast   300 PYCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIKDLSI 364

  Fly   312 VKNLDNLNR----DLKKVIVVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIAQNNV 372
            ||:.:...:    .|..||::|....:..|:.||...:..|..:..|..||:|:.||:  |....
Yeast   365 VKDSEENGKGSSSSLDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLE--AMRYS 427

  Fly   373 DDVREVL 379
            .|||.:|
Yeast   428 TDVRNIL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 35/161 (22%)
NEM1NP_011867.1 FCP1 9..446 CDD:227517 52/202 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.