DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and Ctdnep1

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_080293.1 Gene:Ctdnep1 / 67181 MGIID:1914431 Length:244 Species:Mus musculus


Alignment Length:268 Identity:70/268 - (26%)
Similarity:109/268 - (40%) Gaps:64/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LGFAIFGGSAVAAGFWAVYEFGKPEVDPNGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPS 211
            ||...|  .|.||..|:.:.:                        .|:|..:::..||.:     
Mouse     8 LGLRTF--VAFAAKLWSFFIY------------------------LLRRQIRTVIQYQTV----- 41

  Fly   212 RAKLLP-DPLKPPYVQ--PRYTLVLEMKDVLVH----------------PDWTYQT-----GWRF 252
            |..:|| .||....:.  .|..|||::.:.|:|                ||:..:.     ..||
Mouse    42 RYDILPLSPLSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRF 106

  Fly   253 --KKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIM-YRLVRDATHFVDGHHVKN 314
              .|||.||.||...::.:|:|||||...:....:.|.||.:..|: .|..|.......|.::|:
Mouse   107 FVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKD 171

  Fly   315 LDNLNRDLKKVIVVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREV- 378
            |..::.||..::::|....|.:.||||...:..|..:..|..||:|:..|.  |.....|||.| 
Mouse   172 LSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLD--ALRFTADVRSVL 234

  Fly   379 ---LHYYR 383
               ||.:|
Mouse   235 SRNLHQHR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 41/151 (27%)
Ctdnep1NP_080293.1 HIF-SF_euk 61..229 CDD:274055 47/169 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.