DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and ctdsp1

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:XP_021334687.1 Gene:ctdsp1 / 553744 ZFINID:ZDB-GENE-050522-523 Length:1222 Species:Danio rerio


Alignment Length:363 Identity:91/363 - (25%)
Similarity:138/363 - (38%) Gaps:105/363 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LPAAAPALFSILHTARGYSSTTK--QEAGATGPNDAPEVAPNAPLLAKLFPQTSP---------- 117
            :|...|.|...:.......::|.  .::..|.|.|..|:. |:|.:..|..||.|          
Zfish   918 IPTNDPQLSCTIEELSNTETSTPCVSDSLDTEPKDTSELL-NSPAVGGLAEQTKPNEKLEELIHQ 981

  Fly   118 -------EVDSNAEQERKKR-------EEEEEKENERAWKRMKLGFAIFGGSAVAAGFWAVYEFG 168
                   |.::..:.::||.       |:.|..|:|                          ||.
Zfish   982 VARSEASEQEAICKSDQKKTGEQCDSYEDSESSEDE--------------------------EFS 1020

  Fly   169 KPEVDPNGQ---PIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSRAKLLPDPLKPPYVQPRYT 230
            :   |.:.:   |..|:...|||:.|               |:.....|:              .
Zfish  1021 E---DCDCEICVPPTDQVPAKPLLPQ---------------IKSKDVGKI--------------C 1053

  Fly   231 LVLEMKDVLVHPDWTYQTGWRF---------------KKRPGVDHFLAECAKDFEIVVFTAEQGM 280
            :|:::.:.|||..:.......|               .|||.||.||....:.||.|:|||....
Zfish  1054 VVIDLDETLVHSSFKPVNNADFIIPVEIDGTVHQVYVLKRPHVDEFLKRMGELFECVLFTASLAK 1118

  Fly   281 TVFPILDALDPNGYIMYRLVRDATHFVDGHHVKNLDNLNRDLKKVIVVDWDANATKMHPDNTFGL 345
            ...|:.|.||..|....||.|::..|..|::||:|..|.|||.|||:||....:...||||...:
Zfish  1119 YADPVSDLLDKWGAFRSRLFRESCVFHRGNYVKDLSRLGRDLNKVIIVDNSPASYIFHPDNAVPV 1183

  Fly   346 ARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREVLHYYR 383
            |.|..:..|.:|||||.|.:.:::  ||:|..||...|
Zfish  1184 ASWFDDMSDTELLDLIPFFERLSK--VDNVYTVLKQQR 1219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 46/142 (32%)
ctdsp1XP_021334687.1 HIF-SF_euk 1051..1209 CDD:274055 54/173 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.