DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and ctdnep1

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_001017177.1 Gene:ctdnep1 / 549931 XenbaseID:XB-GENE-5939296 Length:244 Species:Xenopus tropicalis


Alignment Length:269 Identity:73/269 - (27%)
Similarity:106/269 - (39%) Gaps:71/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 GFAIFGGSAVAAGFWAVYEFGKPEVDPNGQPIEDEFTHKPLVQQYLQRMWKSIHYYQRMIQEPSR 212
            ||..|     ||..|:                        .|...|:|..::|..||.:     |
 Frog    12 GFVAF-----AAKLWS------------------------FVLYLLRRQVRTIIQYQTV-----R 42

  Fly   213 AKLLPDPLKPPYVQ-----PRYTLVLEMKDVLVH----------------PDWTYQT-----GWR 251
            ..:|  ||.|....     .|..|||::.:.|:|                ||:..:.     ..|
 Frog    43 YDVL--PLSPASRNRLSQVKRKVLVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVR 105

  Fly   252 F--KKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPN-GYIMYRLVRDATHFVDGHHVK 313
            |  .|||.||.||...::.:|:|||||...:....:.|.||.| |.:..|..|.......|.::|
 Frog   106 FFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNNRGVLRRRFYRQHCTLELGSYIK 170

  Fly   314 NLDNLNRDLKKVIVVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKIIAQNNVDDVREV 378
            :|..::.||..|:::|....|.:.||||...:..|..:..|..||:|:..|.  |.....|||.|
 Frog   171 DLSVVHSDLSSVVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLD--ALRFTADVRSV 233

  Fly   379 ----LHYYR 383
                ||.:|
 Frog   234 LSRNLHQHR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 43/151 (28%)
ctdnep1NP_001017177.1 HIF-SF_euk 61..229 CDD:274055 49/169 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.