DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm50 and CTDSPL2

DIOPT Version :9

Sequence 1:NP_001303557.1 Gene:ttm50 / 31266 FlyBaseID:FBgn0250874 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_057480.2 Gene:CTDSPL2 / 51496 HGNCID:26936 Length:466 Species:Homo sapiens


Alignment Length:334 Identity:80/334 - (23%)
Similarity:125/334 - (37%) Gaps:112/334 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SSTTKQEAGATGPNDAPEVAPN----------------APLLAKLFPQTSPEVDSNAEQERKKRE 131
            :|||....||...|.|.:|.|:                .||.|.:.|      ||.......:..
Human   189 TSTTTSTNGAAYSNQAVQVRPSLNNGLEEAEETVNRDIPPLTAPVTP------DSGYSSAHAEAT 247

  Fly   132 EEEEKENERAWKRMKLGFAIFGGSAVAAGFWAVYEFGKPEVDP-----NGQPI-EDEFTHKPLVQ 190
            .||:                          |.|:       ||     :..|: |::...||.: 
Human   248 YEED--------------------------WEVF-------DPYYFIKHVPPLTEEQLNRKPAL- 278

  Fly   191 QYLQRMWKSIHYYQRMIQEPSRAKLLPDPLKPPYVQPRYTLVLEMKDVLVH-------------- 241
                                        |||.... |.::|||::.:.|||              
Human   279 ----------------------------PLKTRST-PEFSLVLDLDETLVHCSLNELEDAALTFP 314

  Fly   242 ---PDWTYQTGWRFKKRPGVDHFLAECAKDFEIVVFTAEQGMTVFPILDALDPNGYIM-YRLVRD 302
               .|..||...|.  ||....||...::.:||::|||.:.:....:|:.|||...:: :||.|:
Human   315 VLFQDVIYQVYVRL--RPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFRE 377

  Fly   303 ATHFVDGHHVKNLDNLNRDLKKVIVVDWDANATKMHPDNTFGLARWHGNDDDGQLLDLIAFLKII 367
            ....|.|:::|:|:.|.|||.|.|::|....|......|...:..|..:.:|.:||.||.||:.:
Human   378 HCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKL 442

  Fly   368 AQNNVDDVR 376
            .:.| :|||
Human   443 VELN-EDVR 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm50NP_001303557.1 CPDc 227..355 CDD:214729 41/145 (28%)
CTDSPL2NP_057480.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..240 6/25 (24%)
HIF-SF_euk 287..448 CDD:274055 48/163 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.